BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40087 (855 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15535| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_38717| Best HMM Match : Cornifin (HMM E-Value=7.2) 28 8.4 >SB_15535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 837 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -1 Query: 852 KG*KPGAPLLEKGPLRKNL--FFYPREFTNSVIPWTARIQW 736 KG + P+ KGPLR+ + + + + + N V+PW + W Sbjct: 768 KGTRSSRPIPVKGPLREEIEQWLFLKHW-NEVVPWVSSFAW 807 >SB_38717| Best HMM Match : Cornifin (HMM E-Value=7.2) Length = 318 Score = 28.3 bits (60), Expect = 8.4 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -3 Query: 109 SGLALPLALLKSMGDGNHSPSGGPYARLPTK 17 SG+ PLA S D H P GGP A PT+ Sbjct: 33 SGIFSPLASSTSASDSRHRPVGGP-AYSPTE 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,205,241 Number of Sequences: 59808 Number of extensions: 520792 Number of successful extensions: 882 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2431332827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -