BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40081 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 41 1e-05 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 25 0.54 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 25 0.54 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 25 0.54 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 40.7 bits (91), Expect = 1e-05 Identities = 23/62 (37%), Positives = 35/62 (56%) Frame = +2 Query: 11 VLVMCHTRELAFQISKEYERFSKYMSGVRVSVFFGGMPIQKDEEVLKTACPHIVVGTPGR 190 V+++ TREL QI ++ +FS S ++ V +GG + L C HI+V TPGR Sbjct: 276 VVIVSPTRELTIQIWQQIVKFS-LNSILKTVVAYGGTSVMHQRGKLSAGC-HILVATPGR 333 Query: 191 IL 196 +L Sbjct: 334 LL 335 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +1 Query: 328 KQVMMFSATLSKEIRPVCKXFMQD 399 +Q +MFSAT E++ + + F+ + Sbjct: 383 RQTLMFSATFPDEVQHLARRFLNN 406 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 25.4 bits (53), Expect = 0.54 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 627 LDPCLASLPLSTVQGTSKKRFLVWXQFI 710 +DP + VQG +K R++VW + I Sbjct: 379 VDPTAPNAEERRVQGVTKPRYMVWRETI 406 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 25.4 bits (53), Expect = 0.54 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 627 LDPCLASLPLSTVQGTSKKRFLVWXQFI 710 +DP + VQG +K R++VW + I Sbjct: 294 VDPTAPNAEERRVQGVTKPRYMVWRETI 321 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.4 bits (53), Expect = 0.54 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 627 LDPCLASLPLSTVQGTSKKRFLVWXQFI 710 +DP + VQG +K R++VW + I Sbjct: 613 VDPTAPNAEERRVQGVTKPRYMVWRETI 640 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,056 Number of Sequences: 438 Number of extensions: 3661 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -