BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40078 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 1.7 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 6.9 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 9.1 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 658 KCTSPSSLRGHLLKYRNFLKLKK 726 K + L HL++Y+ LK+K+ Sbjct: 425 KAAADQKLEKHLIEYKKMLKIKR 447 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 27 GCECERGSCNMKRLQHMLRAH 89 GC C +G L H+LR + Sbjct: 608 GCRCVKGILLKSGLYHVLRGN 628 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 6.9 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = -2 Query: 151 LTLLALAVAPVSTYAADELQICARSMCCNRFMLQLPRSHSQPKLCVLY 8 LT+L L A + + +C + QLP + + P +LY Sbjct: 271 LTVLWLDSRSTERMIAASVNLICHILCMSDLHWQLPHNSTNPPNILLY 318 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 635 IVLILVLRNVQAQVHSGGISLN 700 IVL+++LR +H G + +N Sbjct: 57 IVLVILLRAGYVLIHIGSVPVN 78 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,542 Number of Sequences: 438 Number of extensions: 3659 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -