BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40076 (880 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 33 0.015 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 33 0.015 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 33 0.015 AF457566-1|AAL68796.1| 147|Anopheles gambiae multiprotein bridg... 25 3.0 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 25 4.0 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 24 5.3 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 24 5.3 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 24 5.3 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 24 5.3 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 24 7.0 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 24 7.0 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 7.0 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 23 9.3 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 23 9.3 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 428 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 481 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 32.7 bits (71), Expect = 0.015 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 300 LSRCQLDEDDEVRDRAVFYSAILD-SGNPQLINDYIINIQVPNPVLLEKSLSDY 458 ++R + ++D VFY +LD +G +LIN+ + +++ +P L E+++ ++ Sbjct: 412 VNRYETGDEDNFSQATVFYRRVLDDAGRQRLINNIVGHLKDASPFLQERAVKNF 465 >AF457566-1|AAL68796.1| 147|Anopheles gambiae multiprotein bridging factor-like proteinprotein. Length = 147 Score = 25.0 bits (52), Expect = 3.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 381 PQLINDYIINIQVPNPVLLEK 443 PQ++NDY VPN ++L K Sbjct: 103 PQIVNDYEAGRGVPNNLILGK 123 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 24.6 bits (51), Expect = 4.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 501 PPRC*RARFDRLKQDNHSTTFLIVPD 424 P RC RAR++ + ++ FLI D Sbjct: 324 PRRCSRARYNETRDEHMGCNFLISSD 349 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 24.2 bits (50), Expect = 5.3 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Frame = -3 Query: 755 GNPNWPGPK--NGF-*PHSPPGLSRFSG--FSKGQMASPK 651 G P PGPK G+ P P G+ F G +GQM PK Sbjct: 408 GRPGAPGPKGPRGYEGPQGPKGMDGFDGEKGERGQM-GPK 446 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 5.3 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 357 CRIRRDHELRRLHLVGSVTTK 295 C++R++ ELRRL + + TK Sbjct: 276 CKLRKETELRRLERLSTQRTK 296 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 5.3 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 357 CRIRRDHELRRLHLVGSVTTK 295 C++R++ ELRRL + + TK Sbjct: 276 CKLRKETELRRLERLSTQRTK 296 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 24.2 bits (50), Expect = 5.3 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -2 Query: 261 LRTSNSRYCSSPNWT*LQNHSVI 193 ++T+N R+C+ PN+T + H I Sbjct: 46 IQTTNCRWCTMPNFTHPRCHGQI 68 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 23.8 bits (49), Expect = 7.0 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 46 NPDAKETGLAHLCEFIEDCEHVTLAVRILH--VLGREGPKARQPSR 177 +P GL +CE +EDC R+ VL R AR P+R Sbjct: 372 DPWRHHPGLVAICETMEDCWDHDAEARLSSSCVLERLSQYARFPTR 417 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.8 bits (49), Expect = 7.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 785 RGPNFSRKGFKVPAPNFP 838 R PN+ +GF+ P FP Sbjct: 229 RDPNYRDQGFREPGQRFP 246 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 7.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 258 RTSNSRYCSSPNWT*LQNHSVINVSNVPRRLA 163 + SNS CSS N+ L+ ++ ++ + VP L+ Sbjct: 1231 QNSNSSNCSSVNYNKLKANNGLSTTTVPPPLS 1262 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 9.3 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +2 Query: 488 QHRGGSHAEEPQEPKESPVEI*TRKAPVVSREGQYTEQLQAIP 616 QH +P P +P T++AP R YT+Q +P Sbjct: 31 QHGPSGPQYQPGVPL-APYPTETQRAPAYGRSQAYTQQPAPVP 72 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 9.3 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +2 Query: 488 QHRGGSHAEEPQEPKESPVEI*TRKAPVVSREGQYTEQLQAIP 616 QH +P P +P T++AP R YT+Q +P Sbjct: 31 QHGPSGPQYQPGVPL-APYPTETQRAPAYGRSQAYTQQPAPVP 72 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 907,698 Number of Sequences: 2352 Number of extensions: 20109 Number of successful extensions: 61 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94266828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -