BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40071 (820 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1 |S... 25 9.8 >SPBC4F6.06 |kin1||microtubule affinity-regulating kinase Kin1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 25.4 bits (53), Expect = 9.8 Identities = 18/74 (24%), Positives = 31/74 (41%) Frame = -1 Query: 445 VITFITRCYSISITQTRMGLAHPKTDPYNM*ETHHYANKTRKGLTFLVISIESRY*NRVC 266 ++ ++ C + M H K + E Y + KGL ++ + + Sbjct: 329 IVLYVLVCGKVPFDDQNMSALHAKIKKGTV-EYPSYLSSDCKGLLSRMLVTDPL---KRA 384 Query: 265 TKREVLNHPSIIRH 224 T EVLNHP +IR+ Sbjct: 385 TLEEVLNHPWMIRN 398 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,168,750 Number of Sequences: 5004 Number of extensions: 60577 Number of successful extensions: 132 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 400438000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -