Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40071
         (820 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF040650-6|AAB95007.2|  325|Caenorhabditis elegans Hypothetical ...    29   4.0  

>AF040650-6|AAB95007.2|  325|Caenorhabditis elegans Hypothetical
           protein T04B8.1 protein.
          Length = 325

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = -3

Query: 581 SVIVHRTTKLAAVSTITLLKCVE-DH*KH*ISTSTSERSAALSILKRYNVYNKMLFNFHN 405
           S  +++ T  A    + L KC+  ++ +   +TST   S  L++LK+ N   K LF F  
Sbjct: 207 STSINQLTIYAGEHRVGLKKCIMFENGRQVPNTSTGGGSQKLNVLKQINKTLKFLFKFKT 266

Query: 404 T 402
           T
Sbjct: 267 T 267


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,252,799
Number of Sequences: 27780
Number of extensions: 335479
Number of successful extensions: 667
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 656
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 667
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 2019417216
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)