BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40068 (248 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1685.09 |rps29||40S ribosomal protein S29|Schizosaccharomyce... 89 1e-19 SPAC12B10.06c |||DUF339 family protein|Schizosaccharomyces pombe... 25 1.9 SPBC1718.06 |msp1|mgm1|mitochondrial GTPase Msp1|Schizosaccharom... 24 2.6 SPAC3A12.16c |tim17||TIM23 translocase complex subunit Tim17|Sch... 24 3.4 SPBC557.03c |pim1|dcd1, ptr2|GDP/GTP exchange factor |Schizosacc... 24 3.4 SPCC4G3.16 |||CMP/dCMP deaminase family|Schizosaccharomyces pomb... 23 4.5 SPAC1687.21 ||SPAC222.01|phosphoglycerate mutase family |Schizos... 23 4.5 SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr 1|||M... 23 4.5 SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |S... 23 5.9 SPAC20G8.01 |cdc17||ATP-dependent DNA ligase Cdc17|Schizosacchar... 23 7.8 SPAC23G3.01 |rpb2|SPAC521.06|DNA-directed RNA polymerase II comp... 23 7.8 SPCC1682.12c |ubp16||ubiquitin C-terminal hydrolase Ubp16|Schizo... 23 7.8 SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomy... 23 7.8 >SPBC1685.09 |rps29||40S ribosomal protein S29|Schizosaccharomyces pombe|chr 2|||Manual Length = 56 Score = 88.6 bits (210), Expect = 1e-19 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = +3 Query: 45 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 206 M H N+W+SHPR+YG+GSR C R GLIRKYGLNI RQ FREYA+DIGF K Sbjct: 1 MAHENVWFSHPRKYGKGSRQCAHTGRRLGLIRKYGLNISRQSFREYANDIGFVK 54 >SPAC12B10.06c |||DUF339 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 139 Score = 24.6 bits (51), Expect = 1.9 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +2 Query: 86 RTRISVMPILLQQA-WLN--PQVRFEHMQTVLQRVCS*HRIQEAGL 214 +T +S + LL+ A +N PQ+RFEH + L+RV + ++A L Sbjct: 4 KTNLSNITTLLRSARCMNRMPQLRFEHTKGDLKRVNRSYETRDAML 49 >SPBC1718.06 |msp1|mgm1|mitochondrial GTPase Msp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 903 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +2 Query: 62 LVFSPSQIRTRISVMPI 112 LV+ PSQIR R+S++ + Sbjct: 26 LVYRPSQIRRRVSLLSL 42 >SPAC3A12.16c |tim17||TIM23 translocase complex subunit Tim17|Schizosaccharomyces pombe|chr 1|||Manual Length = 164 Score = 23.8 bits (49), Expect = 3.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 106 HDRDPCPYL 80 H RDPCPY+ Sbjct: 6 HTRDPCPYV 14 >SPBC557.03c |pim1|dcd1, ptr2|GDP/GTP exchange factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 539 Score = 23.8 bits (49), Expect = 3.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 87 GQGSRSCRSCSNRHGLIRKYGLNICRQC 170 G GS + N+ G + +GLNI RQC Sbjct: 285 GAGSYHSFAIDNK-GRVYAWGLNITRQC 311 >SPCC4G3.16 |||CMP/dCMP deaminase family|Schizosaccharomyces pombe|chr 3|||Manual Length = 405 Score = 23.4 bits (48), Expect = 4.5 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 86 RTRISVMPILLQQAW 130 +T + V+P LLQQ+W Sbjct: 73 KTSVKVVPWLLQQSW 87 >SPAC1687.21 ||SPAC222.01|phosphoglycerate mutase family |Schizosaccharomyces pombe|chr 1|||Manual Length = 209 Score = 23.4 bits (48), Expect = 4.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 178 SLKHCLHMFKPYLRIKP 128 S+K C PYL +KP Sbjct: 54 SMKRCRETIAPYLELKP 70 >SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 1115 Score = 23.4 bits (48), Expect = 4.5 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 14 SLARNNLIS*NGPRKYLVFSPSQIRTRISVMPILLQQAWLNP 139 SLAR +++ GP K L F + T V L + + ++P Sbjct: 918 SLARVSVLRGEGPNKGLPFIDDYVATDDKVTDYLTEYSGIHP 959 >SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1842 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 139 RIKPCLLEQDRHDRDPCPYLRG*EYQI 59 R P LLE ++ D CP +G YQ+ Sbjct: 438 RSNPTLLEFMQYHIDHCPAEKGETYQL 464 >SPAC20G8.01 |cdc17||ATP-dependent DNA ligase Cdc17|Schizosaccharomyces pombe|chr 1|||Manual Length = 768 Score = 22.6 bits (46), Expect = 7.8 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 114 RIGMTEILVRICEGENTKYL 55 +IG+ + L+ CEG KYL Sbjct: 283 KIGVIKRLLSSCEGAEPKYL 302 >SPAC23G3.01 |rpb2|SPAC521.06|DNA-directed RNA polymerase II complex subunit Rpb2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1210 Score = 22.6 bits (46), Expect = 7.8 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 84 YGQGSRSCRSCSNRHGLIRKYGLNICRQCFRE 179 Y + S CRSC NR + Y + F+E Sbjct: 1163 YKKDSYECRSCQNRTRFSQVYLPYAAKLLFQE 1194 >SPCC1682.12c |ubp16||ubiquitin C-terminal hydrolase Ubp16|Schizosaccharomyces pombe|chr 3|||Manual Length = 457 Score = 22.6 bits (46), Expect = 7.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 71 RIPNICVAHFKKLNCFSLTSNKL 3 R PNI HFK+ S+K+ Sbjct: 324 RAPNILTIHFKRFTFNGFQSSKI 346 >SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1583 Score = 22.6 bits (46), Expect = 7.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 163 LHMFKPYLRIKPCLLEQ 113 LH+ KPYLR + EQ Sbjct: 1039 LHLLKPYLRSASTIEEQ 1055 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,029,746 Number of Sequences: 5004 Number of extensions: 18547 Number of successful extensions: 47 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 2,362,478 effective HSP length: 60 effective length of database: 2,062,238 effective search space used: 45369236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -