BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40068 (248 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0486 + 19577507-19577568,19578119-19578218,19581128-195812... 93 4e-20 11_06_0483 + 24118047-24118108,24118952-24119051,24119330-24119338 92 5e-20 03_06_0123 - 31821915-31822094,31822187-31822324,31822413-318228... 92 5e-20 04_04_0910 - 29321128-29321276,29321977-29322508,29323301-293237... 26 4.8 06_03_0897 + 25762154-25763056,25764189-25764800 25 6.4 09_02_0388 - 8450728-8450836,8451114-8451229,8451618-8451827 25 8.5 >12_02_0486 + 19577507-19577568,19578119-19578218,19581128-19581214, 19581852-19581914 Length = 103 Score = 92.7 bits (220), Expect = 4e-20 Identities = 38/55 (69%), Positives = 42/55 (76%) Frame = +3 Query: 45 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKL 209 MGH+N+W SHP+ YG GSR CR C N HGLIRKYGL CRQCFR A DIGF K+ Sbjct: 1 MGHSNVWNSHPKNYGPGSRVCRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIKV 55 >11_06_0483 + 24118047-24118108,24118952-24119051,24119330-24119338 Length = 56 Score = 92.3 bits (219), Expect = 5e-20 Identities = 38/54 (70%), Positives = 41/54 (75%) Frame = +3 Query: 45 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 206 MGH+N+W SHP+ YG GSR CR C N HGLIRKYGL CRQCFR A DIGF K Sbjct: 1 MGHSNVWNSHPKNYGPGSRVCRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIK 54 >03_06_0123 - 31821915-31822094,31822187-31822324,31822413-31822817, 31822897-31823212,31823305-31823543,31823800-31823903, 31823987-31824145,31824326-31824510,31825318-31825427, 31826900-31826947,31827047-31827241,31827354-31827422, 31829521-31829620,31829879-31829940 Length = 769 Score = 92.3 bits (219), Expect = 5e-20 Identities = 38/54 (70%), Positives = 41/54 (75%) Frame = +3 Query: 45 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKK 206 MGH+N+W SHP+ YG GSR CR C N HGLIRKYGL CRQCFR A DIGF K Sbjct: 1 MGHSNVWNSHPKNYGPGSRVCRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIK 54 >04_04_0910 - 29321128-29321276,29321977-29322508,29323301-29323706, 29323933-29324028,29324563-29324645,29326620-29326732, 29327156-29327315 Length = 512 Score = 25.8 bits (54), Expect = 4.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 60 IWYSHPRRYGQGSRSCRSCSNRHG 131 IW H RR G+GS + R +RHG Sbjct: 306 IWPPHARRDGRGSEAAR--MSRHG 327 >06_03_0897 + 25762154-25763056,25764189-25764800 Length = 504 Score = 25.4 bits (53), Expect = 6.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +2 Query: 134 NPQVRFEHMQTVLQRVCS*HRIQEAGLNGVGIINFTFK 247 NP+V + V Q + HR+ E L+ +G +N K Sbjct: 325 NPEVMQKVQDEVRQLLVGQHRVTEESLSKLGYMNLVIK 362 >09_02_0388 - 8450728-8450836,8451114-8451229,8451618-8451827 Length = 144 Score = 25.0 bits (52), Expect = 8.5 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +3 Query: 93 GSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIG 197 G+ C SC NR L K ++ R + DIG Sbjct: 101 GTNPCSSCRNRSLLTAKLNFSLDLNDIRVISEDIG 135 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,735,737 Number of Sequences: 37544 Number of extensions: 125890 Number of successful extensions: 267 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 267 length of database: 14,793,348 effective HSP length: 61 effective length of database: 12,503,164 effective search space used: 262566444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -