BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40059 (844 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 40 2e-05 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 40 2e-05 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 24 2.0 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 24 2.0 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 4.7 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 40.3 bits (90), Expect = 2e-05 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = +3 Query: 720 GQEKTHLYIVVIGHATPGRSTTTGSFVLPNVGGI 821 G+EK H+ IVVIGH G+STTTG + GGI Sbjct: 2 GKEKIHINIVVIGHVDSGKSTTTGHLIY-KCGGI 34 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 40.3 bits (90), Expect = 2e-05 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = +3 Query: 720 GQEKTHLYIVVIGHATPGRSTTTGSFVLPNVGGI 821 G+EK H+ IVVIGH G+STTTG + GGI Sbjct: 2 GKEKIHINIVVIGHVDSGKSTTTGHLIY-KCGGI 34 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 399 NNAYVNIFYDVSDGPNVYNSEV 334 NN N FY S+G N NS+V Sbjct: 136 NNYNDNYFYSKSNGSNSSNSDV 157 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -2 Query: 837 MGTVGQSPPHLVGQMTQWWWTCRES 763 M T G P +M +WWW + S Sbjct: 349 METRGFLQPVCQNEMNKWWWNMKIS 373 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 790 PVVVDLPGV 764 PVVVDLPGV Sbjct: 347 PVVVDLPGV 355 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 238,654 Number of Sequences: 438 Number of extensions: 5135 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27067071 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -