SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV40052
         (866 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4YW89 Cluster: Putative uncharacterized protein; n=1; ...    35   3.1  

>UniRef50_Q4YW89 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium berghei|Rep: Putative uncharacterized protein
           - Plasmodium berghei
          Length = 69

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 4/53 (7%)
 Frame = +3

Query: 297 CLYFNIPQINFIAMKFIISFISLYNY----KKFSKLKN*YLTITKMIYIFCFI 443
           C++FN+P+      K +++    +NY    KK  K KN Y     ++YIFCF+
Sbjct: 8   CIHFNVPKNLIKITKRVLNVERNFNYYKILKKRKKTKNNYPYYYFLLYIFCFL 60


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 806,218,001
Number of Sequences: 1657284
Number of extensions: 16532098
Number of successful extensions: 27608
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 26313
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27591
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 77062818868
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -