BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40051 (860 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14272| Best HMM Match : Sugar_tr (HMM E-Value=0.0046) 29 4.9 SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_14272| Best HMM Match : Sugar_tr (HMM E-Value=0.0046) Length = 775 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = -3 Query: 732 FAFFVKPDWHLIVGPVSIPGV 670 FAFF++ DW +++ VSIPG+ Sbjct: 294 FAFFIR-DWRMLIVAVSIPGL 313 >SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 28.3 bits (60), Expect = 8.5 Identities = 18/65 (27%), Positives = 31/65 (47%) Frame = -3 Query: 678 PGVSSLPALTIHCCDAIFIHTTFYVGI*FPINNCQDNVFLLLGLVMRLHCHLIQVRPNFV 499 PG+ + IH D F F VGI P+ + + + L L +R C++ V + Sbjct: 4 PGLWTSRDKPIHRAD--FAERAFTVGIGGPVGSGKTALVLALCKYLRDSCNICVVTNDIF 61 Query: 498 SQDDW 484 +++DW Sbjct: 62 TKEDW 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,489,239 Number of Sequences: 59808 Number of extensions: 473345 Number of successful extensions: 826 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2455286845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -