BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40047 (876 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 26 0.34 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 3.1 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 4.2 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 4.2 AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase l... 23 4.2 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 26.2 bits (55), Expect = 0.34 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 362 STWMISSVSTPTKTKLNLFLTSGRSLTPRTIPFGM 466 S W I +P + FL +GRS T + +PFG+ Sbjct: 399 SYWQIPL--SPESRQYTAFLYNGRSYTYQVLPFGL 431 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 507 HEHLSEFLRVF--VFGIPNGIVLGVKLLPEVRNRFSFVFV 394 H HLS+ +R+F +FG ++ G+ L + F+ V Sbjct: 858 HHHLSKLIRLFNEIFGHGLLLMFGISFLLVTQTIFALCVV 897 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -1 Query: 189 FLGSYVGGAAQSVSEPTTADTCGWWATV 106 F+ S GG S+ + T CG W + Sbjct: 208 FVLSRAGGLVNSLYQNATRKVCGVWKRI 235 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 662 IRRQREHEFFSAPHPH 615 I R + FF +PHPH Sbjct: 338 IHRTVDDYFFCSPHPH 353 >AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase like protein E1 protein. Length = 139 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -2 Query: 635 FSAPHPHSGDGGIVVFTKQADGC 567 F AP P G++ TK+ D C Sbjct: 16 FKAPQPPENWTGVLDATKEGDPC 38 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,655 Number of Sequences: 336 Number of extensions: 4708 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24203322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -