BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40045 (882 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1834 + 40214378-40214563,40214728-40214818,40215006-402150... 29 6.5 >01_06_1834 + 40214378-40214563,40214728-40214818,40215006-40215093, 40215444-40215695,40215927-40216101,40216243-40216329, 40216445-40216513,40216638-40216734,40217010-40217092, 40217373-40217480,40217672-40217793,40217921-40218028, 40218121-40218194,40218492-40218617,40219655-40219722, 40219930-40220079,40220164-40220214,40220678-40220734, 40220824-40220970,40221064-40221155,40221516-40221625, 40221728-40221791,40221883-40222032,40222554-40222788 Length = 929 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 714 SYMVIFSNDKLPNIPHFHWVSLNNDVRTNYKVY 616 SY + D PN+ F W+++ +R N+ Y Sbjct: 846 SYPTLHRRDDYPNLSWFSWINICLSLRVNFACY 878 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,803,600 Number of Sequences: 37544 Number of extensions: 261020 Number of successful extensions: 368 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2491484208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -