BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40045 (882 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z71186-6|CAI79167.1| 183|Caenorhabditis elegans Hypothetical pr... 30 2.5 Z70754-2|CAC42308.1| 764|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z70754-1|CAA94771.2| 966|Caenorhabditis elegans Hypothetical pr... 29 4.4 AF164113-1|AAD45535.1| 810|Caenorhabditis elegans zinc finger p... 29 4.4 Z69902-2|CAA93764.1| 326|Caenorhabditis elegans Hypothetical pr... 28 7.7 >Z71186-6|CAI79167.1| 183|Caenorhabditis elegans Hypothetical protein F23D12.8 protein. Length = 183 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/54 (31%), Positives = 30/54 (55%) Frame = -1 Query: 825 LRVKKFFWIHQDLGHSEIPLIRFKSFNSPVVSNFFLISYMVIFSNDKLPNIPHF 664 +R KK +W H ++ L+ KSF + +++F SYM +F++ + NI F Sbjct: 31 MRKKKTYWDK----HPDLKLL--KSFGTRRLTSFMFFSYMFLFASAEYTNILQF 78 >Z70754-2|CAC42308.1| 764|Caenorhabditis elegans Hypothetical protein F58E6.1b protein. Length = 764 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/60 (28%), Positives = 26/60 (43%) Frame = -3 Query: 514 HFC*KNCFFFSYLIVR*RKYFFINEKQLIRYKKNSFIVSMDGVRMDN*YETFTILSCALN 335 +F K F + R RK N K + +Y KN+ +S + N TFT ++ N Sbjct: 620 YFSFKYTFMNRTALNRRRKNLANNPKNIFKYSKNNINLSYSNIVASNILRTFTFINSKSN 679 >Z70754-1|CAA94771.2| 966|Caenorhabditis elegans Hypothetical protein F58E6.1a protein. Length = 966 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/60 (28%), Positives = 26/60 (43%) Frame = -3 Query: 514 HFC*KNCFFFSYLIVR*RKYFFINEKQLIRYKKNSFIVSMDGVRMDN*YETFTILSCALN 335 +F K F + R RK N K + +Y KN+ +S + N TFT ++ N Sbjct: 620 YFSFKYTFMNRTALNRRRKNLANNPKNIFKYSKNNINLSYSNIVASNILRTFTFINSKSN 679 >AF164113-1|AAD45535.1| 810|Caenorhabditis elegans zinc finger protein STAT-B protein. Length = 810 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/60 (28%), Positives = 26/60 (43%) Frame = -3 Query: 514 HFC*KNCFFFSYLIVR*RKYFFINEKQLIRYKKNSFIVSMDGVRMDN*YETFTILSCALN 335 +F K F + R RK N K + +Y KN+ +S + N TFT ++ N Sbjct: 666 YFSFKYTFMNRTALNRRRKNLANNPKNIFKYSKNNINLSYSNIVASNILRTFTFINSKSN 725 >Z69902-2|CAA93764.1| 326|Caenorhabditis elegans Hypothetical protein C47D12.3 protein. Length = 326 Score = 28.3 bits (60), Expect = 7.7 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = -1 Query: 798 HQDLGHSEIPLIRFKSFNSPVVSNFFLISYMVIFSNDKLPNIPHFHWVSLNNDVRTNY 625 H D G L R ++ V N + M+ F KLP++ FHWV+ + + NY Sbjct: 83 HPDTGEKMFILGRM---SAQVPCNMLITGGMLTFYQ-KLPHVIFFHWVNQSFNAIVNY 136 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,856,127 Number of Sequences: 27780 Number of extensions: 279720 Number of successful extensions: 577 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2223883816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -