BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40041 (887 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0069 + 536787-537068,537193-537493,537528-537581,538848-53... 36 0.057 08_02_1082 + 24225592-24226422 29 4.9 01_01_0047 + 334809-334877,334966-335074,335159-335299,336337-33... 29 6.5 11_06_0657 + 25938382-25938443,25938511-25938718,25939222-259392... 28 8.6 >01_01_0069 + 536787-537068,537193-537493,537528-537581,538848-539241, 539345-539595,539678-539798,539893-540133,540341-540445, 540571-540615,540738-540890,541132-541410,541705-541841, 541975-542017,542228-542329 Length = 835 Score = 35.5 bits (78), Expect = 0.057 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +3 Query: 270 GQPATIAASSETSGVYTMTSSELTTRLKIDAMSEDSRTDYDESHYD 407 G +I++SS TSG TM S +L R D ++ED T Y S D Sbjct: 180 GDDPSISSSSATSGAVTMVSGKLVVREDGDELAEDESTRYVTSATD 225 >08_02_1082 + 24225592-24226422 Length = 276 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +3 Query: 261 DGLGQPATIAASSETSGVYTMTSSELTTRLKIDAMSEDSRTD 386 + + T +++ T+ T+SE+TT L + A+ EDS TD Sbjct: 171 EATSEKKTTTSTTTTTPPAPDTTSEITTELVVPAVEEDSFTD 212 >01_01_0047 + 334809-334877,334966-335074,335159-335299,336337-336498, 336577-336734,337180-337310,337385-337472,337587-337690, 338346-338444,339060-339116,339262-339337,339519-339602, 339969-340010,340128-340198,341516-341564,342370-342441, 343149-343286,343393-343473,344166-344353,344591-345188, 345274-345342,346729-346854,347048-347175,347986-348142, 348342-348388,348472-348535,348691-348765,349292-349414, 349797-349982,351179-351303,351390-351459,351974-352101, 352585-352726,353065-353163,353239-353285,353598-353652, 353758-353967,354686-354757,354836-354905,355231-355414, 355521-355644,355732-355863,356252-356317,356805-356852, 357572-357676,357728-357865,358097-358399,358482-358594, 359082-359148,359236-359310,359395-359517,359610-359618, 360156-360320,360401-360502,361545-361696,361794-361995, 362079-362126,362215-362298,362613-362657,363302-363385, 363890-363970,364044-364133,364217-364279,364824-364841, 365238-365378,365494-365550,366091-366185,366275-366383, 367067-367156,367308-367387,367480-367558,367742-367903, 368005-368136,368335-368469,368553-368618,369317-369457, 369575-369648,369685-369910 Length = 2905 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 672 LTASGLSDLIVGXGXFILKNHP 737 L A G D+ + G +ILKNHP Sbjct: 2095 LRAQGQHDMAINLGKYILKNHP 2116 >11_06_0657 + 25938382-25938443,25938511-25938718,25939222-25939268, 25939473-25939805,25940529-25940613,25940689-25940884, 25941012-25941182,25941261-25941318,25941429-25941657, 25942296-25943183 Length = 758 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 324 TSSELTTRLKIDAMSEDSRTDYDESHY-DCYKQAKE 428 T E L+ D + +DSR+D+ E+++ D Y K+ Sbjct: 405 TMEEFLASLEKDLLQDDSRSDFTETYWGDAYNAVKQ 440 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,988,419 Number of Sequences: 37544 Number of extensions: 298642 Number of successful extensions: 601 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2495239620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -