BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40041 (887 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24398| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_25762| Best HMM Match : VWD (HMM E-Value=2.2e-16) 29 5.0 >SB_24398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 500 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 411 YKQAKENDLAEFDSISSILKNKAETLNHVTNS 506 YK+ +END+ ++ S ++ A TL HVT S Sbjct: 81 YKEPEENDVIDYILDSEAVQKVAMTLGHVTTS 112 >SB_25762| Best HMM Match : VWD (HMM E-Value=2.2e-16) Length = 705 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +3 Query: 258 YDGLGQPATIAASSETSGVYTMTSSELTTR 347 Y G+G P T AS T+GV T T + TTR Sbjct: 296 YQGVGAPKT-TASPTTAGVVTTTGAPSTTR 324 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,202,108 Number of Sequences: 59808 Number of extensions: 359807 Number of successful extensions: 681 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 681 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2538363813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -