BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40040 (876 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; ... 86 1e-15 >UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 77 Score = 85.8 bits (203), Expect = 1e-15 Identities = 42/62 (67%), Positives = 46/62 (74%) Frame = -1 Query: 216 YIQAYMTYIGIYLKLADPVDFVVPQSINKRPTLLYKINLKQTKGIRPTGDTSKGKQNAFS 37 Y ++ I + LADP DFVVPQSINKRP LYKINLKQTKGIR TGDTSK KQN + Sbjct: 8 YPHTELSQILFMIILADPADFVVPQSINKRPKHLYKINLKQTKGIRQTGDTSKEKQNCYF 67 Query: 36 YL 31 YL Sbjct: 68 YL 69 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 817,300,790 Number of Sequences: 1657284 Number of extensions: 16238092 Number of successful extensions: 31326 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 30222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31313 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 78292544701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -