BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40040 (876 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) 30 2.1 SB_26977| Best HMM Match : WD40 (HMM E-Value=1.9e-10) 28 8.6 >SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) Length = 747 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 44 AFCFPFDVSPVGRIPFVCFKFILYNNVGLLFI 139 A C PFDVS G I +V F L N F+ Sbjct: 440 AICLPFDVSTTGSIAYVAFLLFL-NGAAFAFV 470 >SB_26977| Best HMM Match : WD40 (HMM E-Value=1.9e-10) Length = 345 Score = 28.3 bits (60), Expect = 8.6 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +1 Query: 496 SNRILYRVSISDIESIYFLN 555 S++ILYR++I ++ YFLN Sbjct: 178 SHKILYRINIDGLQHFYFLN 197 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,056,416 Number of Sequences: 59808 Number of extensions: 475020 Number of successful extensions: 854 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -