BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40039 (881 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 27 1.0 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 9.3 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 26.6 bits (56), Expect = 1.0 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -1 Query: 383 YSETRSFMLLSASVNSISSMPSPVYQCKKALR-LNIAVN 270 + +TR+ +L S N+I S+P ++ LR LNI+ N Sbjct: 167 FGQTRNLEVLDLSTNNIWSLPDHLFCSLSGLRSLNISSN 205 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 9.3 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +1 Query: 136 ILRGMDPQQREDRRVRHSPSWSQDGRHLHRKLHRH--PGA 249 +L QQ++ +++ H PS S HL + H PGA Sbjct: 79 VLSSSAQQQQQQQQLLHHPSSSPHSNHLLGGPNHHLPPGA 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 851,256 Number of Sequences: 2352 Number of extensions: 17476 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94680279 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -