BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40038 (755 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0628 - 25643006-25643123,25643314-25643471,25643559-256436... 62 4e-10 01_05_0142 - 18564697-18564792,18564824-18564928,18565606-185656... 35 0.080 05_01_0168 + 1162459-1162785,1163609-1163719,1163853-1163969,116... 30 2.3 02_01_0336 + 2397648-2397812,2398367-2398441,2398860-2398975,239... 29 3.0 10_01_0359 + 3956527-3956616,3957623-3957818,3958102-3959418,395... 29 5.3 04_01_0617 - 8076624-8076971,8077761-8077883,8077965-8078035,807... 28 9.2 >11_06_0628 - 25643006-25643123,25643314-25643471,25643559-25643687, 25644378-25644451,25644771-25644798 Length = 168 Score = 62.5 bits (145), Expect = 4e-10 Identities = 36/84 (42%), Positives = 49/84 (58%) Frame = +3 Query: 255 IVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRF 434 IV RL E F DKK + ++K Y+K L AKL+ ++ E FK N+ K +LG+ Sbjct: 70 IVDTFRLQEQPPF-DKKQFVTFMKRYIKNLSAKLDA---EKQEEFKKNIEGATKYLLGKL 125 Query: 435 KELQFFTGESMDCDGMVAMMEYRD 506 K+LQFF GESM DG + Y+D Sbjct: 126 KDLQFFVGESMHDDGGLVFAYYKD 149 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 3/62 (4%) Frame = +1 Query: 55 MKIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEG 225 M +Y+D++TGDE+ SD++ + ++ +++EV G+ V + D+ I G NPSAE DEG Sbjct: 1 MLVYQDLLTGDELLSDSFPYREIENGILWEVDGKWVVQGAIDVDI-GANPSAEGGGDDEG 59 Query: 226 TD 231 D Sbjct: 60 VD 61 >01_05_0142 - 18564697-18564792,18564824-18564928,18565606-18565678, 18566262-18567637 Length = 549 Score = 34.7 bits (76), Expect = 0.080 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 5/80 (6%) Frame = -1 Query: 587 ISYLTFRISLLLDH-V*KTS*LVFAYHQVSIFHHGNHAITIHGLPSKEL----KFLKPAE 423 IS+LT +++ L++ + + H+ FHH H ++ PSK+L ++L+ Sbjct: 214 ISFLTDKVAQSLENFIQYHPRAIQEAHRPKDFHHMLHLFQMYLKPSKKLVEGSQYLERGR 273 Query: 422 DVFHYFVHVCFKYFNLVRRL 363 FH F ++C++Y + R+L Sbjct: 274 -YFHSFANICYRYLKIGRKL 292 >05_01_0168 + 1162459-1162785,1163609-1163719,1163853-1163969, 1164082-1164240,1164663-1164797,1165116-1165268, 1165358-1165479,1165599-1166541,1166677-1166728, 1166873-1167963,1168058-1168384,1168479-1168559, 1168649-1168717,1168809-1168937,1169038-1169121, 1169210-1169275 Length = 1321 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +3 Query: 294 GDKKSYTL-YLKDYMKKLV-AKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQFFTGESM 467 G +K TL L++Y+ +V A L+ +Q+E FK +NKV K L+ F+ + M Sbjct: 1140 GSEKMVTLDNLEEYVSSIVDATLKSGISNQIEAFKAGINKVF-----ALKTLRLFSEDEM 1194 Query: 468 D 470 + Sbjct: 1195 E 1195 >02_01_0336 + 2397648-2397812,2398367-2398441,2398860-2398975, 2399155-2399269,2399360-2399488,2399809-2399856, 2400369-2400448,2400628-2400824,2400916-2401202, 2401281-2401307,2401353-2401538,2401633-2402094, 2402201-2402350,2402612-2402687,2402851-2402978, 2403244-2403435,2403559-2403690,2403767-2403889, 2404128-2404346,2404518-2404679 Length = 1022 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -3 Query: 369 APSLPILLLIFSYSL*GTMCRISCHRRRMFRLACGSGLFNS 247 APS + + SYSL GT + RR +F LA +F S Sbjct: 687 APSFQVAFSLMSYSLEGTDSLLPSRRRSLFTLATSMIMFFS 727 >10_01_0359 + 3956527-3956616,3957623-3957818,3958102-3959418, 3959482-3960445,3960588-3960648,3961500-3961946 Length = 1024 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/65 (27%), Positives = 30/65 (46%) Frame = +3 Query: 267 HRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ 446 H L+ A D S +L ++++ V +E+A Q+EV K + K+I EL Sbjct: 177 HELIRAGAENDALSRSLEEREHLMMKVGGEKEQAESQIEVLKGTIQSGEKEISSLKYELH 236 Query: 447 FFTGE 461 + E Sbjct: 237 VLSKE 241 >04_01_0617 - 8076624-8076971,8077761-8077883,8077965-8078035, 8078108-8078360,8078613-8078768,8078854-8079770, 8079858-8079927,8082310-8082416,8082722-8082755, 8083621-8083940,8084031-8084820,8084890-8085046, 8085647-8086068 Length = 1255 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +1 Query: 160 TRAQGDIQIEGFNPSAEEADEGTDSAVES 246 TR+ +Q++GF PSA ++ +G+ + V S Sbjct: 827 TRSSDKVQLKGFVPSAPKSSQGSRTYVSS 855 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,513,630 Number of Sequences: 37544 Number of extensions: 382971 Number of successful extensions: 816 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 814 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -