BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40038 (755 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 0.75 SB_23747| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 25.8 bits (54), Expect(2) = 0.75 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +2 Query: 590 LHNSKLAP*YFCFFIYLSIMSASWQELAFSHHRLNHFV 703 LH SK YFC I L W A SHHR++HF+ Sbjct: 61 LHTSK----YFCMLILLQ-----W---ATSHHRVSHFL 86 Score = 24.2 bits (50), Expect(2) = 0.75 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 677 SHHRLNHFVFKKNYCLPQLNNLTIH 751 SHHR++H F + CLP + T H Sbjct: 99 SHHRVSH--FPSSGCLPIIGYPTSH 121 >SB_23747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 853 Score = 27.9 bits (59), Expect = 9.4 Identities = 26/102 (25%), Positives = 46/102 (45%) Frame = +3 Query: 267 HRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ 446 H+LVE +++ ++ +D LVA Q VF+ + N V K G K Sbjct: 734 HKLVEKRLVSNQQQRSIRFRDQRPHLVA--------QGVVFEPDANDVSK---GTLKVTG 782 Query: 447 FFTGESMDCDGMVAMMEYRDLMVRKYQS*CFSNMV*KKRNSK 572 F G+++ + +V + Y D + + S S + KK ++K Sbjct: 783 FVRGQTLSANRLVHLAGYGDFQISQIDSVADSFSI-KKSSTK 823 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,586,045 Number of Sequences: 59808 Number of extensions: 445123 Number of successful extensions: 984 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 981 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -