BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40036 (890 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0196 - 15374814-15374997,15375304-15375547,15376035-153762... 40 0.002 02_04_0016 + 18930395-18930581,18930640-18930668 28 8.7 >12_02_0196 - 15374814-15374997,15375304-15375547,15376035-15376237, 15377275-15377502,15377674-15377819,15378020-15378233, 15378410-15378543,15378986-15379135,15379892-15380155, 15380962-15381051 Length = 618 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/46 (43%), Positives = 29/46 (63%) Frame = +3 Query: 6 IDLVVGMMAEKHLPGSLLGPTATSLFKEQLWRTRIADRYFYSHVNE 143 +DL+VG+MAEK + G + TA ++F R ADR+F S+ NE Sbjct: 527 LDLLVGLMAEKKIKGFAISETAFNIFILMASRRLEADRFFTSNFNE 572 >02_04_0016 + 18930395-18930581,18930640-18930668 Length = 71 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 689 TPRFPRPKIS*VDIISTWISQP 624 TP PRP ++ +D+ S WIS P Sbjct: 9 TPGHPRPGLAALDLDSPWISMP 30 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,706,173 Number of Sequences: 37544 Number of extensions: 525443 Number of successful extensions: 1248 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1247 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2506954360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -