BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40033 (846 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0524 + 3943581-3943610,3943889-3944050,3944403-3944637,394... 29 4.7 >03_01_0524 + 3943581-3943610,3943889-3944050,3944403-3944637, 3945626-3945666,3946101-3946145,3947119-3947246, 3947446-3947554,3947641-3947694 Length = 267 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 739 NKYTGGQIGPLNYYPKGHVLDKQVNINIADSG 644 N Y G G NYY GHV D ++ AD G Sbjct: 75 NSYKYGYSGAGNYYSYGHVYDMNDYMHRADGG 106 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,993,314 Number of Sequences: 37544 Number of extensions: 239865 Number of successful extensions: 401 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 401 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -