BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40033 (846 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 31 1.6 SB_30462| Best HMM Match : DUF964 (HMM E-Value=2.8) 29 6.3 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = -3 Query: 760 GQIRRPFNKYTGGQIGPLNYYPKGHVLDKQVNINIADSG 644 G++ R F K G +IG YYP G +D++ IADSG Sbjct: 562 GELARSFGK-VGREIGEF-YYPSGISVDEKNRFIIADSG 598 >SB_30462| Best HMM Match : DUF964 (HMM E-Value=2.8) Length = 204 Score = 28.7 bits (61), Expect = 6.3 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 672 CLSKTWPFG**FKGPICPPVYLLKGRRI-WPVPREPNP*AL 791 C+ KTW FKGP P + L+ R++ PV R P AL Sbjct: 159 CIFKTWTVDKYFKGP--PEKHCLRNRKVLLPVVRASKPIAL 197 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 840 ARFNIPPQPFHTGPPIKGPRD*APLG 763 A +PP P HTGPP P P G Sbjct: 423 ANMRLPPPPQHTGPPQPRPPHGMPQG 448 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,064,417 Number of Sequences: 59808 Number of extensions: 254603 Number of successful extensions: 327 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 325 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -