BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40032 (892 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1271.02 |stt3||oligosaccharyltransferase subunit Stt3|Schizo... 28 1.6 SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolo... 26 8.3 >SPBC1271.02 |stt3||oligosaccharyltransferase subunit Stt3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 28.3 bits (60), Expect = 1.6 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -3 Query: 338 CLIGVLELVCLTGSLAGVTTDFCGTFFSIHHHYYRHLMIP 219 CL+G+ +V S GV + G F+S+ Y + IP Sbjct: 311 CLVGLATVVLFALSSTGVIAPWTGRFYSLWDTNYAKIHIP 350 >SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolog 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 925 Score = 25.8 bits (54), Expect = 8.3 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 748 LQVCRRTLTHSFWFRFFHLHCYHRYLLKILSSWLQGSFSR 629 +Q+C + F FR H YLL+ +SS ++ FS+ Sbjct: 571 MQLCSSLSSPRFLFRNPRNHLLLEYLLQAISSIVENKFSQ 610 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,784,463 Number of Sequences: 5004 Number of extensions: 47466 Number of successful extensions: 125 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -