BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40024 (708 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 24 4.1 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 9.4 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 9.4 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +2 Query: 509 TGDTEGQKDRRELKSLMKRRIYNKERKIKYSTRK 610 TG+ E +K ++ +R++ K+ K + STR+ Sbjct: 536 TGEWEREKAEKQFYHTARRKVLRKKGKKQRSTRR 569 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.0 bits (47), Expect = 9.4 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = -3 Query: 619 YHQFSCGIFDFPLFVVNSSLHQ*FKLSSIFLTFCVS-SVLKNFK----PSSSR*SCFVKN 455 Y+Q+ + + P FVVNS L +F VS S L++ PS CF + Sbjct: 146 YYQYYGALSECPQFVVNSYLEDLQVAYDLFGMLAVSQSTLQSLAGGCFPSGEESLCFFYS 205 Query: 454 RFSFQTALASVGTG 413 F ++ L SV G Sbjct: 206 -FVTRSGLYSVEDG 218 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.0 bits (47), Expect = 9.4 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 5/74 (6%) Frame = -3 Query: 619 YHQFSCGIFDFPLFVVNSSLHQ*FKLSSIFLTFCVS-SVLKNFK----PSSSR*SCFVKN 455 Y+Q+ + + P FVVNS L +F VS S L++ PS CF + Sbjct: 146 YYQYYGALSECPQFVVNSYLEDLQVAYDLFGMLAVSQSTLQSLAGGCFPSGEESLCFFYS 205 Query: 454 RFSFQTALASVGTG 413 F ++ L SV G Sbjct: 206 -FVTRSGLYSVEDG 218 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 556,439 Number of Sequences: 2352 Number of extensions: 9420 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -