BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40024 (708 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC028363-1|AAH28363.1| 931|Homo sapiens phosphatidylinositol gl... 31 5.3 AL137607-1|CAB70839.1| 825|Homo sapiens hypothetical protein pr... 31 5.3 AF109219-1|AAD11432.1| 931|Homo sapiens Mcd4p homolog protein. 31 5.3 >BC028363-1|AAH28363.1| 931|Homo sapiens phosphatidylinositol glycan anchor biosynthesis, class N protein. Length = 931 Score = 30.7 bits (66), Expect = 5.3 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Frame = -3 Query: 160 PWTLLSCSLVIVLNVLVYFDSHSTCPFSFFFYSLVQILHLQFAALK---ILRDLV 5 P LL CS V + ++ +F CP++++ Y L+ L + +A L+ +++DLV Sbjct: 480 PSHLLPCSFVAIGILVAFFLLIQACPWTYYVYGLLP-LPIWYAVLREFQVIQDLV 533 >AL137607-1|CAB70839.1| 825|Homo sapiens hypothetical protein protein. Length = 825 Score = 30.7 bits (66), Expect = 5.3 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Frame = -3 Query: 160 PWTLLSCSLVIVLNVLVYFDSHSTCPFSFFFYSLVQILHLQFAALK---ILRDLV 5 P LL CS V + ++ +F CP++++ Y L+ L + +A L+ +++DLV Sbjct: 374 PSHLLPCSFVAIGILVAFFLLIQACPWTYYVYGLLP-LPIWYAVLREFQVIQDLV 427 >AF109219-1|AAD11432.1| 931|Homo sapiens Mcd4p homolog protein. Length = 931 Score = 30.7 bits (66), Expect = 5.3 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Frame = -3 Query: 160 PWTLLSCSLVIVLNVLVYFDSHSTCPFSFFFYSLVQILHLQFAALK---ILRDLV 5 P LL CS V + ++ +F CP++++ Y L+ L + +A L+ +++DLV Sbjct: 480 PSHLLPCSFVAIGILVAFFLLIQACPWTYYVYGLLP-LPIWYAVLREFQVIQDLV 533 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,522,428 Number of Sequences: 237096 Number of extensions: 1303457 Number of successful extensions: 6746 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6746 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8231208258 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -