BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40023 (818 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 23 3.9 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 23 3.9 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 5.1 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -1 Query: 407 LLKTAIYLTVKQPY*FTITCYS*CLQYCIN 318 +L + ++ V +P ++ CL YC N Sbjct: 260 VLNSVLFQNVYKPLPIVLSIVKNCLSYCFN 289 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -1 Query: 407 LLKTAIYLTVKQPY*FTITCYS*CLQYCIN 318 +L + ++ V +P ++ CL YC N Sbjct: 260 VLNSVLFQNVYKPLPIVLSIVKNCLSYCFN 289 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -2 Query: 259 VCTNTFEKTFRHFFSFLIRC 200 VC N++ F H F F C Sbjct: 62 VCFNSYMYAFTHIFFFFAIC 81 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,214 Number of Sequences: 336 Number of extensions: 4279 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22414104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -