BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40023 (818 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33653| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 >SB_33653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 30.7 bits (66), Expect = 1.5 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +3 Query: 684 GNYYLTYNFYLGKLNQERPWGGKI 755 G+YY T++ Y+ +L + + W GK+ Sbjct: 311 GSYYSTFSMYINRLRKHKRWRGKL 334 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/47 (25%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +3 Query: 432 KILRDMEITCYFISAY-RFNHSIEFIMLSFVVCLKPLQIYSTVIFNH 569 +IL+ + YF+ R N ++ ++L ++ C++P+ Y+ +F+H Sbjct: 1197 EILKKINKRLYFLRQLKRANIKVKELLLFYLTCIRPVTEYACPVFHH 1243 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,424,129 Number of Sequences: 59808 Number of extensions: 430822 Number of successful extensions: 834 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -