BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40020 (852 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) 32 0.68 SB_43576| Best HMM Match : EGF_CA (HMM E-Value=2.7e-38) 30 2.7 >SB_45045| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1260 Score = 31.9 bits (69), Expect = 0.68 Identities = 18/40 (45%), Positives = 23/40 (57%) Frame = +3 Query: 24 LINIPRSGQRCHGRLQTLGRTEASDFSSSEDHLSMISYVR 143 L+ PRS +RCH + TE SDF SE LS+ S +R Sbjct: 303 LLRDPRSRRRCHSDYE----TEDSDFMESESELSIDSLLR 338 >SB_43576| Best HMM Match : EGF_CA (HMM E-Value=2.7e-38) Length = 641 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/52 (32%), Positives = 31/52 (59%) Frame = +3 Query: 267 MICVKALLGSS*SIYVNYHIIIVNKEIVIL*KHNDSILNYILEQHNVKKKQN 422 MI V + SS S+ ++ +II+ I I ++ I+N ++ QH+ +K+QN Sbjct: 526 MILVPVITPSSSSLALSSTVIIIITIITISIINSMIIINIVINQHHHQKQQN 577 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,568,910 Number of Sequences: 59808 Number of extensions: 418628 Number of successful extensions: 666 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2419355818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -