BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40017 (868 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 25 1.2 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.6 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.6 bits (51), Expect = 1.2 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +3 Query: 3 ERDSAIKMLEEKDIIIISLKD--EIEKLKHQSLNSSEVPNEDNMSTSTMSK 149 ER+ + L +K I+ L+ EIEKL + S + D STS SK Sbjct: 48 EREREHERLMKKMILEYELRRIREIEKLGSERSKSRSPDSRDRSSTSNTSK 98 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 24.2 bits (50), Expect = 1.6 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 666 RDENPNPTTRGFNNSGGNPKTGS*KRDFQQALE 764 +++ P ++ NN+ GN T S RD A+E Sbjct: 527 QNQVPLTSSSNVNNNSGNGNTNSSARDSSPAIE 559 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,235 Number of Sequences: 438 Number of extensions: 4005 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28038087 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -