BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40015 (826 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 94 2e-21 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 43 3e-06 AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein pro... 43 4e-06 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 3.4 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 4.5 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 22 7.9 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 7.9 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 93.9 bits (223), Expect = 2e-21 Identities = 41/70 (58%), Positives = 56/70 (80%) Frame = +1 Query: 46 EFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTE 225 +F+GK+YK+ SSENFD+FMK +GVG++TRK ++V+P VEL ++ Y L T+S FK TE Sbjct: 3 DFLGKRYKLYSSENFDDFMKALGVGIMTRKVGSSVSPVVELTENNGLYTLKTTSPFKNTE 62 Query: 226 MKFKPGEEFE 255 +KFK GEEFE Sbjct: 63 IKFKLGEEFE 72 Score = 70.5 bits (165), Expect = 2e-14 Identities = 34/61 (55%), Positives = 40/61 (65%) Frame = +3 Query: 255 EDRADGAKVKSVCTFEGNTLKQVQKAPDGIEVTYVREFGPEEMKAVMTAKDVTCTRVYKV 434 E+ DG KVKSVCT +GN L QVQK + T REF EMKA+M D+ CTRVYK+ Sbjct: 73 EETVDGRKVKSVCTLDGNKLIQVQKGEK--QTTIEREFSSTEMKAIMKVDDIICTRVYKI 130 Query: 435 Q 437 Q Sbjct: 131 Q 131 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 43.2 bits (97), Expect = 3e-06 Identities = 25/73 (34%), Positives = 36/73 (49%) Frame = +1 Query: 43 MEFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTT 222 ++F GK ++ S NF+EF K +G + P+ EL K+GDE+ +SS T Sbjct: 2 VQFEGK-FQFVSQNNFEEFAKVLGDQNLVNTVLQP-RPSFELSKNGDEWTFTSSSGDNTY 59 Query: 223 EMKFKPGEEFERT 261 FK FE T Sbjct: 60 TKTFKMNVPFEET 72 >AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein protein. Length = 105 Score = 42.7 bits (96), Expect = 4e-06 Identities = 25/72 (34%), Positives = 35/72 (48%) Frame = +1 Query: 46 EFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTE 225 +F GK ++ S NF+EF K +G + P+ EL K+GDE+ +SS T Sbjct: 1 QFEGK-FQFVSQNNFEEFAKVLGDQNLVNTVLQP-RPSFELSKNGDEWTFTSSSGDNTYT 58 Query: 226 MKFKPGEEFERT 261 FK FE T Sbjct: 59 KTFKMNVPFEET 70 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 460 RESVPPIHEHPAAQLCYLASILYIS 534 RES+PP + P L Y SI ++ Sbjct: 263 RESLPPTEKTPLISLYYGVSICLVT 287 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 4.5 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -3 Query: 230 FISVVLKVEEVTKLYSSPSLRSSTV 156 FIS+++ +E+ + +SP L + T+ Sbjct: 9 FISLIILNDEIYNIIASPQLNNPTL 33 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.8 bits (44), Expect = 7.9 Identities = 10/48 (20%), Positives = 24/48 (50%) Frame = +3 Query: 306 NTLKQVQKAPDGIEVTYVREFGPEEMKAVMTAKDVTCTRVYKVQ*KDS 449 + +K + +PD +E ++ E + + KDV+ ++ +Q D+ Sbjct: 184 SNIKVISISPDLVETDMTAQWLKENSRLALKPKDVSNCVLFALQTPDN 231 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.8 bits (44), Expect = 7.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 Query: 713 PMKRIF*ITNXNFAHKRPTRCYRG 642 P+KR+ TN N K P+R G Sbjct: 141 PIKRVKDSTNCNCGWKNPSRIVGG 164 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,986 Number of Sequences: 438 Number of extensions: 4477 Number of successful extensions: 18 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26338809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -