BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40014 (853 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 29 0.047 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 29 0.047 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 29 0.047 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 28 0.082 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 25 0.76 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 5.4 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 9.4 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 29.1 bits (62), Expect = 0.047 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = +2 Query: 149 EKRDIVARPQEQIRSIF---FFRCYKHKKLEAC 238 E RD+V RP ++R F F+C K K + C Sbjct: 132 EMRDLVTRPSYRLRKFFDELLFKCMKEKWIPLC 164 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 29.1 bits (62), Expect = 0.047 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = +2 Query: 149 EKRDIVARPQEQIRSIF---FFRCYKHKKLEAC 238 E RD+V RP ++R F F+C K K + C Sbjct: 365 EMRDLVTRPSYRLRKFFDELLFKCMKEKWIPLC 397 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 29.1 bits (62), Expect = 0.047 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = +2 Query: 149 EKRDIVARPQEQIRSIF---FFRCYKHKKLEAC 238 E RD+V RP ++R F F+C K K + C Sbjct: 365 EMRDLVTRPSYRLRKFFDELLFKCMKEKWIPLC 397 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 28.3 bits (60), Expect = 0.082 Identities = 12/54 (22%), Positives = 30/54 (55%) Frame = +2 Query: 203 FRCYKHKKLEACIMKDIMNTSPRNTLSTTRRPISLTPVQDALLATSPSEIRASK 364 + +H ++ I+ + T P T+ ++RP++ P + ++L T+ S++R + Sbjct: 19 YNVIQHSPQQSIIVSGSI-TQPTKTVIQSKRPLAPAPERTSVLVTNNSDLRCKR 71 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 25.0 bits (52), Expect = 0.76 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +2 Query: 107 GLQFCQKFSQCVP-EEKRDIVARPQ 178 G+ +C K +CVP ++KR IVAR Q Sbjct: 58 GVLYCMK-CECVPLQKKRRIVARVQ 81 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -1 Query: 307 KRNRASRGRKRIPWRSVHDVLHDAR 233 K+N +S+ + R +RSV DV+ + Sbjct: 230 KKNDSSKKKTRYYYRSVDDVIEKGK 254 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/36 (25%), Positives = 16/36 (44%) Frame = +2 Query: 53 ARIGSLPVSDELKGDIQEGLQFCQKFSQCVPEEKRD 160 A G + + D K + Q+ + C K + PE + Sbjct: 287 AMCGLVLICDSAKSESQQTVFLCYKLMEKFPERSHE 322 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,452 Number of Sequences: 336 Number of extensions: 3215 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -