BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40014 (853 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.6 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 4.7 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 22 6.2 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 3.6 Identities = 13/57 (22%), Positives = 23/57 (40%) Frame = +2 Query: 254 MNTSPRNTLSTTRRPISLTPVQDALLATSPSEIRASKPWRKWRCTCMTILAEGAPSI 424 + T P L I+ P + A L S+ + WR W+ + + + PS+ Sbjct: 824 ITTPPTPNLLRYFASIATNPKEQAQLNLLASDPAVYEDWRHWKFPNLVEVLDEFPSV 880 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.6 bits (46), Expect = 4.7 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 795 IKFNQDLIIEYVQNSILLSLP 733 I F D+I+ + NS+++ LP Sbjct: 216 IVFGSDMIVRSIGNSLMVILP 236 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = +2 Query: 152 KRDIVARPQEQIRSIFFFRCYKHKKLEACIMK 247 KRD+ ++ + + F + K + CI+K Sbjct: 11 KRDVFIEKEQMMNILMFLPSWDGKMPQPCILK 42 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,913 Number of Sequences: 438 Number of extensions: 4104 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -