BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40014 (853 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g09660.1 68418.m01117 malate dehydrogenase, glyoxysomal ident... 28 9.1 At1g59850.1 68414.m06741 expressed protein 28 9.1 >At5g09660.1 68418.m01117 malate dehydrogenase, glyoxysomal identical to SP|Q9ZP05; identical to cDNA microbody NAD-dependent malate dehydrogenase GI:3929650 Length = 354 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 56 RIGSLPVSDELKGDIQEGLQFCQK 127 RIG DEL G IQ+G++F +K Sbjct: 331 RIGLEKAKDELAGSIQKGVEFIRK 354 >At1g59850.1 68414.m06741 expressed protein Length = 498 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/47 (29%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = -1 Query: 331 EQSVLNGSKRNRASRGRKRIPW-RSVHDVLHDARLQFLVLVASEEEN 194 +++V++ KRNR++ G KR+ + +H V + + V+ +S+EE+ Sbjct: 359 QEAVVSKEKRNRSTLGAKRVLFPAKMHKVKENGSNKSQVVQSSDEES 405 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,763,887 Number of Sequences: 28952 Number of extensions: 297913 Number of successful extensions: 752 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1980143200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -