BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40011 (360 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) simila... 62 8e-11 At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) simila... 62 8e-11 At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) simila... 62 8e-11 At3g10440.1 68416.m01252 hypothetical protein 28 1.6 At2g14010.1 68415.m01557 hypothetical protein and genefinder 27 3.8 At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)... 27 5.0 At1g06660.1 68414.m00706 expressed protein 27 5.0 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 26 6.6 At3g26260.1 68416.m03276 Ulp1 protease family protein contains P... 26 6.6 At3g16520.3 68416.m02110 UDP-glucoronosyl/UDP-glucosyl transfera... 26 6.6 At3g16520.2 68416.m02109 UDP-glucoronosyl/UDP-glucosyl transfera... 26 6.6 At3g16520.1 68416.m02108 UDP-glucoronosyl/UDP-glucosyl transfera... 26 6.6 At2g37100.1 68415.m04552 protamine P1 family protein contains Pf... 26 6.6 At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family... 26 6.6 At1g21475.1 68414.m02687 hypothetical protein 26 6.6 >At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 62.5 bits (145), Expect = 8e-11 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = +3 Query: 9 LPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDDYF 158 L SGLLLVTGPF N PLRR+ Q YVIGTST++ + L K F+D YF Sbjct: 113 LASGLLLVTGPFKINGVPLRRVNQAYVIGTSTKVDISGVTLDK-FDDKYF 161 Score = 33.9 bits (74), Expect = 0.033 Identities = 23/46 (50%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +2 Query: 224 KKREIRSI*AGKTD-QKTVDEAVIKAIGARPDKKVLRGYLKAAFGL 358 +K E + I GK D QK VD A+IKAI A P+ L+ YL A F L Sbjct: 180 EKEEKKEIPQGKKDDQKAVDAALIKAIEAVPE---LKTYLGARFSL 222 >At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 62.5 bits (145), Expect = 8e-11 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = +3 Query: 9 LPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDDYF 158 L SGLLLVTGPF N PLRR+ Q YVIGTST++ + L K F+D YF Sbjct: 113 LASGLLLVTGPFKINGVPLRRVNQAYVIGTSTKVDISGVTLDK-FDDKYF 161 Score = 33.5 bits (73), Expect = 0.043 Identities = 22/45 (48%), Positives = 28/45 (62%) Frame = +2 Query: 224 KKREIRSI*AGKTDQKTVDEAVIKAIGARPDKKVLRGYLKAAFGL 358 +K+EI + K DQK VD A+IKAI A P+ L+ YL A F L Sbjct: 183 EKKEIPQV--KKDDQKAVDAALIKAIEAVPE---LKTYLGARFSL 222 >At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) similar to 60S ribosomal protein L6 GI:7208784 from [Cicer arietinum] Length = 233 Score = 62.5 bits (145), Expect = 8e-11 Identities = 38/83 (45%), Positives = 46/83 (55%), Gaps = 1/83 (1%) Frame = +3 Query: 9 LPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDDYFXXXXXXXXXX 188 L SGLLLVTGPF N PLRR+ Q YVIGTST+I + K F+D YF Sbjct: 113 LSSGLLLVTGPFKINGVPLRRVNQAYVIGTSTKIDISGVNTEK-FDDKYF---GKVAEKK 168 Query: 189 XXXXEGDDIFATKKE-KYVPSEQ 254 EG+ A K+E K +P E+ Sbjct: 169 KKKTEGEFFEAEKEEKKEIPQEK 191 Score = 34.3 bits (75), Expect = 0.025 Identities = 20/34 (58%), Positives = 23/34 (67%) Frame = +2 Query: 257 KTDQKTVDEAVIKAIGARPDKKVLRGYLKAAFGL 358 K DQKTVD A+IK+I A P+ KV YL A F L Sbjct: 192 KEDQKTVDAALIKSIEAVPELKV---YLGARFSL 222 >At3g10440.1 68416.m01252 hypothetical protein Length = 556 Score = 28.3 bits (60), Expect = 1.6 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 249 EQAKPIRRQSTRL*SKPSEPDPTRRCSADTSKR 347 E P+RR+S RL S+ EP + S +T+KR Sbjct: 307 ESRFPLRRRSARLKSQEPEPSESFHDSIETTKR 339 >At2g14010.1 68415.m01557 hypothetical protein and genefinder Length = 833 Score = 27.1 bits (57), Expect = 3.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 307 GSDGFDHSLVDCLLIGFACSDGTYFSFFV 221 G GFDH L++C GF + YF F V Sbjct: 731 GMYGFDHDLLECTHSGF---ERVYFPFLV 756 >At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5) identical to heat shock protein 70 [Arabidopsis thaliana] GI:6746590 Length = 682 Score = 26.6 bits (56), Expect = 5.0 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 355 SEGRFEVSAEHLLVGSGSDGFDHSLVDCLLIGFACSDG 242 S G FEV A + G + FD++L+D L+ F ++G Sbjct: 261 SNGVFEVKATNGDTFLGGEDFDNALLDFLVNEFKTTEG 298 >At1g06660.1 68414.m00706 expressed protein Length = 481 Score = 26.6 bits (56), Expect = 5.0 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 7/85 (8%) Frame = +1 Query: 115 SATSNCQNTSMMITSR---RIRSASN----VQSNAKRVMTSLPQKKRNTFHLSRQNRSED 273 S TS +S +I R RI SAS+ V+S + L + R TF + N+S Sbjct: 166 SFTSEQTASSCVIDVRDNARISSASSDGTEVESVGTAIKGELDRTARPTFTAGK-NKSVR 224 Query: 274 SRRGCDQSHRSPTRQEGAPRIPQSG 348 DQS+ S + + G+ R P+ G Sbjct: 225 FECDLDQSNSSNSSENGSSRKPEMG 249 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +3 Query: 243 PSEQAKPIRRQSTRL*SKPSEPDPTRRCSADTSKRPSD 356 PS + P + +T P P P S D S PSD Sbjct: 279 PSPSSSPAQSPATPSPMTPQSPSPVSSPSPDQSAAPSD 316 >At3g26260.1 68416.m03276 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 989 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 307 GSDGFDHSLVDCLLIGFACSDGTYFSFFV 221 G GFDH L++C GF YF F V Sbjct: 845 GMYGFDHDLLECTPSGFG---RVYFPFLV 870 >At3g16520.3 68416.m02110 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 462 Score = 26.2 bits (55), Expect = 6.6 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 29 SYWTFCFQFVPA-TPYSSALCDRHLHQN 109 S+ + F +PA TPYSS+ RH H++ Sbjct: 60 SFPSITFHHLPAVTPYSSSSTSRHHHES 87 >At3g16520.2 68416.m02109 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 446 Score = 26.2 bits (55), Expect = 6.6 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 29 SYWTFCFQFVPA-TPYSSALCDRHLHQN 109 S+ + F +PA TPYSS+ RH H++ Sbjct: 60 SFPSITFHHLPAVTPYSSSSTSRHHHES 87 >At3g16520.1 68416.m02108 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 451 Score = 26.2 bits (55), Expect = 6.6 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 29 SYWTFCFQFVPA-TPYSSALCDRHLHQN 109 S+ + F +PA TPYSS+ RH H++ Sbjct: 60 SFPSITFHHLPAVTPYSSSSTSRHHHES 87 >At2g37100.1 68415.m04552 protamine P1 family protein contains Pfam PF00260: Protamine P1 Length = 297 Score = 26.2 bits (55), Expect = 6.6 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 216 FATKKEKYVPSEQAKPIRRQSTRL*SKPSEPDPTRR 323 F+ K EK S +++PI +ST +P EP+ TR+ Sbjct: 133 FSKKSEKRSSSSRSEPIFGRST---VEPEEPEETRK 165 >At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family protein Length = 523 Score = 26.2 bits (55), Expect = 6.6 Identities = 19/84 (22%), Positives = 33/84 (39%) Frame = +1 Query: 91 SAPPPEFHSATSNCQNTSMMITSRRIRSASNVQSNAKRVMTSLPQKKRNTFHLSRQNRSE 270 S PPPE ++ + S K ++ S P ++ + + R Sbjct: 186 SPPPPESKPGQADPPDNIFNALGNEFSHPSGA-GRGKPLVESAPIRQEDNRQIRRPPPPP 244 Query: 271 DSRRGCDQSHRSPTRQEGAPRIPQ 342 +R Q R+PT ++G P+ PQ Sbjct: 245 QQQRVQPQQKRAPTVKDGTPK-PQ 267 >At1g21475.1 68414.m02687 hypothetical protein Length = 181 Score = 26.2 bits (55), Expect = 6.6 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +1 Query: 136 NTSMMITSRR--IRSASNVQSNAKRVMTSLPQKKRNTFHLSRQNRSEDSRRGC 288 ++S TSRR I +A N +SNA + + L + F + D RGC Sbjct: 2 SSSSSQTSRRPYISAALNSRSNAAKTLNELIKIHGLEFAFKKDGVKRDMERGC 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,962,678 Number of Sequences: 28952 Number of extensions: 146835 Number of successful extensions: 495 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 494 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 469342752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -