BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40010 (613 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15200.1 68418.m01781 40S ribosomal protein S9 (RPS9B) 40S ri... 141 4e-34 At5g39850.1 68418.m04829 40S ribosomal protein S9 (RPS9C) 40S ri... 138 2e-33 At5g15750.1 68418.m01842 RNA-binding S4 domain-containing protei... 32 0.26 At5g01850.1 68418.m00104 protein kinase, putative similar to pro... 31 0.80 At4g32190.1 68417.m04581 centromeric protein-related low similar... 29 2.4 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 29 3.2 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 28 4.2 At1g43730.1 68414.m05028 hypothetical protein 28 4.2 At5g41310.1 68418.m05020 kinesin motor protein-related 27 7.4 At5g28615.1 68418.m03493 hypothetical protein 27 7.4 At4g15880.1 68417.m02413 Ulp1 protease family protein contains P... 27 9.8 At1g60720.1 68414.m06835 hypothetical protein 27 9.8 >At5g15200.1 68418.m01781 40S ribosomal protein S9 (RPS9B) 40S ribosomal protein S9, Chlamydomonas sp., EMBL:AU066528 Length = 198 Score = 141 bits (341), Expect = 4e-34 Identities = 66/85 (77%), Positives = 76/85 (89%) Frame = +3 Query: 255 RIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQVV 434 R G+LDE Q KLDYVL L +E+FLERRLQT VFK+G+AKSIHH+R+LIRQRHIRV KQ+V Sbjct: 84 RYGLLDESQNKLDYVLALTVENFLERRLQTIVFKSGMAKSIHHSRVLIRQRHIRVGKQLV 143 Query: 435 NIPSFIVRLDSGKHIDFSLKSPFGG 509 NIPSF+VRLDS KHIDF+L SPFGG Sbjct: 144 NIPSFMVRLDSQKHIDFALTSPFGG 168 Score = 119 bits (286), Expect = 2e-27 Identities = 51/73 (69%), Positives = 65/73 (89%) Frame = +1 Query: 34 FSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKDP 213 + KT+ PRRP+EK RLD ELK++GEYGLRNKRE+WRV+Y+L+RIR AAR+LLTL+EK P Sbjct: 10 YGKTFKGPRRPYEKERLDSELKLVGEYGLRNKRELWRVQYSLSRIRNAARDLLTLDEKSP 69 Query: 214 KRLFEGNALLRRL 252 +R+FEG ALLRR+ Sbjct: 70 RRIFEGEALLRRM 82 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 4/22 (18%) Frame = +2 Query: 509 GRPGRVKRKN----LRKGQGGG 562 GRPGRVKR+N +K GGG Sbjct: 169 GRPGRVKRRNEKSASKKASGGG 190 >At5g39850.1 68418.m04829 40S ribosomal protein S9 (RPS9C) 40S ribosomal protein S9 - Chlamydomonas sp.,EMBL:AU066528 Length = 197 Score = 138 bits (335), Expect = 2e-33 Identities = 64/85 (75%), Positives = 76/85 (89%) Frame = +3 Query: 255 RIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQVV 434 R G+LDE Q KLDYVL L +E+FLERRLQT VFK+G+AKSIHHAR+LIRQRHIRV +Q+V Sbjct: 84 RYGLLDETQNKLDYVLALTVENFLERRLQTIVFKSGMAKSIHHARVLIRQRHIRVGRQLV 143 Query: 435 NIPSFIVRLDSGKHIDFSLKSPFGG 509 NIPSF+VR++S KH+DFSL SPFGG Sbjct: 144 NIPSFMVRVESQKHVDFSLTSPFGG 168 Score = 122 bits (294), Expect = 2e-28 Identities = 56/82 (68%), Positives = 69/82 (84%) Frame = +1 Query: 7 MVNNRVPSVFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARE 186 MVN R + KT+ PRRP+EK RLD ELK++GEYGLR KRE+WRV+YTL+RIR AARE Sbjct: 1 MVNVRFYRNYGKTFKKPRRPYEKERLDAELKLVGEYGLRCKRELWRVQYTLSRIRNAARE 60 Query: 187 LLTLEEKDPKRLFEGNALLRRL 252 LLTL+EK+P+R+FEG ALLRR+ Sbjct: 61 LLTLDEKNPRRIFEGEALLRRM 82 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 509 GRPGRVKRKNLRKG 550 GRPGRVKR+N R G Sbjct: 169 GRPGRVKRRNERAG 182 >At5g15750.1 68418.m01842 RNA-binding S4 domain-containing protein 40S RIBOSOMAL PROTEINs - different species Length = 182 Score = 32.3 bits (70), Expect = 0.26 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +3 Query: 306 LKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQVVNIPSFIV 455 L + F RRL T + A+ A I Q H+RV + + P+F+V Sbjct: 99 LSVSSFCRRRLSTVLVHLKFAEHHKEAVTYIEQGHVRVGPETITDPAFLV 148 >At5g01850.1 68418.m00104 protein kinase, putative similar to protein kinase [Arabidopsis thaliana] gi|1054633|emb|CAA63387; contains protein kinase domain, Pfam:PF00069 Length = 333 Score = 30.7 bits (66), Expect = 0.80 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 Query: 518 QDDPTERRFQREVNVLARVQAHN 450 Q E RF REVN+++RVQ HN Sbjct: 55 QQSSLESRFVREVNMMSRVQHHN 77 >At4g32190.1 68417.m04581 centromeric protein-related low similarity to SP|Q02224 Centromeric protein E (CENP-E protein) {Homo sapiens} Length = 783 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +1 Query: 109 EYGLRNKREVWRVKYTLARIRKAARELLTLEEKDPKRLFEGNALLRRLVVLEYWMK 276 +YG+ NKR V + +T +R E+L ++ + E N ++ RL E +K Sbjct: 599 DYGMENKRLVMELSFTRENLRMKEMEVLAVQRALTFKDEEINVVMGRLEAKEQELK 654 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 40 KTYVTPRR-PFEKARLDQ-ELKIIGEYGLRNKREVWRVKYT 156 K ++ PRR P + Q E K EYG RN E W + T Sbjct: 479 KYFIKPRRHPESECSATQTEYKFTSEYGKRNSSECWAMTTT 519 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 278 TDETRLCAWSED*GLLGASSADAGVQSW 361 T E CAWS LL + S DA + W Sbjct: 265 TSEVCACAWSPSASLLASGSGDATARIW 292 >At1g43730.1 68414.m05028 hypothetical protein Length = 320 Score = 28.3 bits (60), Expect = 4.2 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 Query: 396 SKFWHDGWTSPGQL 355 +KFWHD WT G L Sbjct: 77 AKFWHDNWTGHGPL 90 >At5g41310.1 68418.m05020 kinesin motor protein-related Length = 961 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +1 Query: 340 RRRCSKLAWRSPSIMPEF*SGKGIFVSASKL*TSHH 447 RRR S A S + F G F+ AS++ TSHH Sbjct: 141 RRRWSLPADHSKGVDSNFNDGGSQFIEASEINTSHH 176 >At5g28615.1 68418.m03493 hypothetical protein Length = 149 Score = 27.5 bits (58), Expect = 7.4 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 Query: 396 SKFWHDGWTSPGQL 355 +KFWHD WT G L Sbjct: 9 AKFWHDDWTGLGPL 22 >At4g15880.1 68417.m02413 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; low similarity to sentrin/SUMO-specific protease [Homo sapiens] GI:6906859; identical to cDNA hypothetical protein, partial (1189 bp) GI:2326349 Length = 489 Score = 27.1 bits (57), Expect = 9.8 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 25 PSVFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREV 138 P K PR PF D+E ++ + RN+R+V Sbjct: 242 PKTVEKRVEVPREPFIPLTEDEEAEVYRAFSGRNRRKV 279 >At1g60720.1 68414.m06835 hypothetical protein Length = 289 Score = 27.1 bits (57), Expect = 9.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -2 Query: 390 FWHDGWTSPGQL 355 FWHD WTS G L Sbjct: 25 FWHDSWTSLGPL 36 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,576,874 Number of Sequences: 28952 Number of extensions: 286031 Number of successful extensions: 805 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -