BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40007 (658 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 1.2 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 1.2 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 26 1.2 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 26 1.2 AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding pr... 25 2.1 AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding pr... 25 2.1 AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine pr... 25 2.1 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 6.4 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 6.4 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 8.5 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -1 Query: 442 KVNSLESEEQQERHHKTEQTHSLRQGETQ 356 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -1 Query: 442 KVNSLESEEQQERHHKTEQTHSLRQGETQ 356 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -1 Query: 442 KVNSLESEEQQERHHKTEQTHSLRQGETQ 356 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 192 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 220 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -1 Query: 442 KVNSLESEEQQERHHKTEQTHSLRQGETQ 356 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding protein AgamOBP54 protein. Length = 176 Score = 25.0 bits (52), Expect = 2.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 298 EGAEDCSNSSSGTSYPTVAAPAPMNLAAESMSLV 197 +GAEDCS+S TS P + +S+ L+ Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLL 84 >AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding protein OBP5470 protein. Length = 144 Score = 25.0 bits (52), Expect = 2.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 298 EGAEDCSNSSSGTSYPTVAAPAPMNLAAESMSLV 197 +GAEDCS+S TS P + +S+ L+ Sbjct: 14 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLL 47 >AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine protein 1 protein. Length = 162 Score = 25.0 bits (52), Expect = 2.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 298 EGAEDCSNSSSGTSYPTVAAPAPMNLAAESMSLV 197 +GAEDCS+S TS P + +S+ L+ Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLECKLKSLGLL 84 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 170 CRELCRDSITICVWVVYCCKWSHQCR 93 C R+ +TIC+ YC +S +CR Sbjct: 800 CSWCKRNGLTICIEKCYCVSFS-RCR 824 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 Query: 98 CRVAEDGRPGCRGDQSG 48 C E G+ CRGD G Sbjct: 304 CAGGEKGKDSCRGDSGG 320 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 8.5 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = +1 Query: 22 LIKTKCCLPPD*SPLQPGLPSSATLHWCDHLQQYTTHTQMVMLSLH 159 +I + CLPPD PG S+T+ +L Y + +++++++ Sbjct: 1815 IINEEDCLPPDNDKGYPGNCGSSTI-GITYLLAYLVISFLIVINMY 1859 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,196 Number of Sequences: 2352 Number of extensions: 15246 Number of successful extensions: 47 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -