BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40005 (718 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 28 0.33 DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary ... 23 9.5 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 27.9 bits (59), Expect = 0.33 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = +3 Query: 207 KEDDGSDTKIAPYTSVWSTASI 272 ++++ S T APYTS+WS+ ++ Sbjct: 170 RDENESITPFAPYTSIWSSPTV 191 >DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary secreted peptide withTIL domain protein. Length = 85 Score = 23.0 bits (47), Expect = 9.5 Identities = 16/65 (24%), Positives = 29/65 (44%) Frame = +1 Query: 349 PKSIGAPALPHRMLAICDISADPGGSIEFMNECTTIDTPFCLYDADRNKDTKSSKVQEYL 528 PK G + R C+ + D G + + + +D FC RN++ K V+ + Sbjct: 23 PKKCGENEIYQRCGTGCERTCDNGDTWDKPCKAACVDKCFCKDGFLRNENGKC--VRAWH 80 Query: 529 CVPSI 543 C P++ Sbjct: 81 CNPNL 85 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 762,467 Number of Sequences: 2352 Number of extensions: 15805 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -