BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40003 (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 3.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.1 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 9.5 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 9.5 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 9.5 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 315 ISENAYQLPQYYVGGRNDDPPSPVYQSPYGGGTW 416 I+E A LP Y + +P++ S Y G W Sbjct: 100 ITEVAPVLPGNYANASSVGSRNPIHTSSYMTGIW 133 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 315 ISENAYQLPQYYVGGRNDDPPSPVYQSPYGGGTW 416 I+E A LP Y + +P++ S Y G W Sbjct: 333 ITEVAPVLPGNYANASSVGSRNPIHTSSYMTGIW 366 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 315 ISENAYQLPQYYVGGRNDDPPSPVYQSPYGGGTW 416 I+E A LP Y + +P++ S Y G W Sbjct: 333 ITEVAPVLPGNYANASSVGSRNPIHTSSYMTGIW 366 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 363 NDDPPSPVYQSPYGGGT 413 +DD SP+ ++ YGG T Sbjct: 17 SDDESSPLTENIYGGST 33 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 363 NDDPPSPVYQSPYGGGT 413 +DD SP+ ++ YGG T Sbjct: 17 SDDESSPLTENIYGGST 33 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 363 NDDPPSPVYQSPYGGGT 413 +DD SP+ ++ YGG T Sbjct: 17 SDDESSPLTENIYGGST 33 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 363 NDDPPSPVYQSPYGGGT 413 +DD SP+ ++ YGG T Sbjct: 17 SDDESSPLTENIYGGST 33 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 229 FVDCFEVLLLFDTSEHY 179 ++ CF +LL + S+HY Sbjct: 5 YIACFLLLLYYIYSKHY 21 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +1 Query: 643 DICSWYIDW 669 +ICS+Y DW Sbjct: 286 EICSFYSDW 294 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +1 Query: 136 NSVNFKMFKHQLSSRNVHSY 195 NS+ FK+ H+ +H Y Sbjct: 1410 NSLTFKLKPHESDVEPIHGY 1429 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,751 Number of Sequences: 336 Number of extensions: 4279 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -