BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40003 (687 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC028985-1|AAH28985.1| 476|Homo sapiens thyroid hormone recepto... 33 0.95 BC021540-1|AAH21540.1| 476|Homo sapiens thyroid hormone recepto... 33 0.95 BC004999-1|AAH04999.1| 476|Homo sapiens thyroid hormone recepto... 33 0.95 BC004249-1|AAH04249.1| 476|Homo sapiens thyroid hormone recepto... 33 0.95 BC002680-1|AAH02680.1| 474|Homo sapiens thyroid hormone recepto... 33 0.95 AF312032-5|AAK21007.1| 476|Homo sapiens thyroid receptor intera... 33 0.95 AF093836-1|AAD03037.1| 476|Homo sapiens zyxin-related protein 1... 33 0.95 AF000974-1|AAB62222.1| 476|Homo sapiens ZRP-1 protein. 33 0.95 AJ001902-1|CAA05080.1| 476|Homo sapiens TRIP6 protein. 32 2.2 >BC028985-1|AAH28985.1| 476|Homo sapiens thyroid hormone receptor interactor 6 protein. Length = 476 Score = 33.1 bits (72), Expect = 0.95 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 339 PQYYVGGRNDDPPSPVYQSPYGGGTWRSYSKA 434 P Y G +P SP+ SPYGG T SY+ A Sbjct: 129 PAYRTGSLKPNPASPLPASPYGGPTPASYTTA 160 >BC021540-1|AAH21540.1| 476|Homo sapiens thyroid hormone receptor interactor 6 protein. Length = 476 Score = 33.1 bits (72), Expect = 0.95 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 339 PQYYVGGRNDDPPSPVYQSPYGGGTWRSYSKA 434 P Y G +P SP+ SPYGG T SY+ A Sbjct: 129 PAYRTGSLKPNPASPLPASPYGGPTPASYTTA 160 >BC004999-1|AAH04999.1| 476|Homo sapiens thyroid hormone receptor interactor 6 protein. Length = 476 Score = 33.1 bits (72), Expect = 0.95 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 339 PQYYVGGRNDDPPSPVYQSPYGGGTWRSYSKA 434 P Y G +P SP+ SPYGG T SY+ A Sbjct: 129 PAYRTGSLKPNPASPLPASPYGGPTPASYTTA 160 >BC004249-1|AAH04249.1| 476|Homo sapiens thyroid hormone receptor interactor 6 protein. Length = 476 Score = 33.1 bits (72), Expect = 0.95 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 339 PQYYVGGRNDDPPSPVYQSPYGGGTWRSYSKA 434 P Y G +P SP+ SPYGG T SY+ A Sbjct: 129 PAYRTGSLKPNPASPLPASPYGGPTPASYTTA 160 >BC002680-1|AAH02680.1| 474|Homo sapiens thyroid hormone receptor interactor 6 protein. Length = 474 Score = 33.1 bits (72), Expect = 0.95 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 339 PQYYVGGRNDDPPSPVYQSPYGGGTWRSYSKA 434 P Y G +P SP+ SPYGG T SY+ A Sbjct: 127 PAYRTGSLKPNPASPLPASPYGGPTPASYTTA 158 >AF312032-5|AAK21007.1| 476|Homo sapiens thyroid receptor interacting protein 6 protein. Length = 476 Score = 33.1 bits (72), Expect = 0.95 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 339 PQYYVGGRNDDPPSPVYQSPYGGGTWRSYSKA 434 P Y G +P SP+ SPYGG T SY+ A Sbjct: 129 PAYRTGSLKPNPASPLPASPYGGPTPASYTTA 160 >AF093836-1|AAD03037.1| 476|Homo sapiens zyxin-related protein 1 protein. Length = 476 Score = 33.1 bits (72), Expect = 0.95 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 339 PQYYVGGRNDDPPSPVYQSPYGGGTWRSYSKA 434 P Y G +P SP+ SPYGG T SY+ A Sbjct: 129 PAYRTGSLKPNPASPLPASPYGGPTPASYTTA 160 >AF000974-1|AAB62222.1| 476|Homo sapiens ZRP-1 protein. Length = 476 Score = 33.1 bits (72), Expect = 0.95 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 339 PQYYVGGRNDDPPSPVYQSPYGGGTWRSYSKA 434 P Y G +P SP+ SPYGG T SY+ A Sbjct: 129 PAYRTGSLKPNPASPLPASPYGGPTPASYTTA 160 >AJ001902-1|CAA05080.1| 476|Homo sapiens TRIP6 protein. Length = 476 Score = 31.9 bits (69), Expect = 2.2 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 339 PQYYVGGRNDDPPSPVYQSPYGGGTWRSYSKA 434 P Y G +P SP+ SPYGG T SY+ A Sbjct: 129 PAYRTGCLKPNPASPLPASPYGGPTPASYTTA 160 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,903,337 Number of Sequences: 237096 Number of extensions: 2305221 Number of successful extensions: 4528 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4528 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -