BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40002 (741 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g36230.1 68418.m04371 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 28 7.5 At4g28790.2 68417.m04116 basic helix-loop-helix (bHLH) family pr... 27 9.9 At4g28790.1 68417.m04117 basic helix-loop-helix (bHLH) family pr... 27 9.9 >At5g36230.1 68418.m04371 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein low similarity to SP|Q13144 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Homo sapiens}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 411 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 231 TNRTQHEYNIRVFNESLLEQIL-LKISDIYNIRVIWD 338 T++ E N+ ES+ +QI K+ DI +RV+WD Sbjct: 261 TSKVTEESNVDEVIESVKQQIKDAKLPDIEVVRVVWD 297 >At4g28790.2 68417.m04116 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 340 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/62 (20%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +2 Query: 464 KGCTIARNMGASKRALKDVLHILYEYLKTFEVSDYIRA-YEIFIACSSNTKKQFIMELTE 640 +G AR+ +SKR+ ++H L E + ++++ ++A E+ C+ + + ++ E Sbjct: 262 QGTEEARDSTSSKRSRAAIMHKLSERRRRQKINEMMKALQELLPRCTKTDRSSMLDDVIE 321 Query: 641 FI 646 ++ Sbjct: 322 YV 323 >At4g28790.1 68417.m04117 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 413 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/62 (20%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +2 Query: 464 KGCTIARNMGASKRALKDVLHILYEYLKTFEVSDYIRA-YEIFIACSSNTKKQFIMELTE 640 +G AR+ +SKR+ ++H L E + ++++ ++A E+ C+ + + ++ E Sbjct: 262 QGTEEARDSTSSKRSRAAIMHKLSERRRRQKINEMMKALQELLPRCTKTDRSSMLDDVIE 321 Query: 641 FI 646 ++ Sbjct: 322 YV 323 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,480,768 Number of Sequences: 28952 Number of extensions: 203715 Number of successful extensions: 437 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 437 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -