BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31056 (788 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14570| Best HMM Match : Mab-21 (HMM E-Value=0.00069) 38 0.007 SB_25577| Best HMM Match : Mab-21 (HMM E-Value=1e-05) 38 0.012 SB_51861| Best HMM Match : RVT_1 (HMM E-Value=1.2e-10) 32 0.46 SB_6743| Best HMM Match : Mab-21 (HMM E-Value=0.086) 31 1.1 SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_11982| Best HMM Match : GST_N (HMM E-Value=7.9e-15) 29 3.2 SB_9403| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_26017| Best HMM Match : Extensin_2 (HMM E-Value=0.11) 29 5.7 SB_3202| Best HMM Match : AFP (HMM E-Value=2.9) 29 5.7 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 28 7.5 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 28 7.5 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 28 7.5 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 28 7.5 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 28 7.5 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 28 7.5 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 28 7.5 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 28 7.5 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 28 7.5 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 28 7.5 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 28 7.5 SB_14744| Best HMM Match : 7tm_1 (HMM E-Value=4e-11) 28 7.5 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 28 7.5 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 28 7.5 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 28 7.5 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 28 7.5 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 28 7.5 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 28 7.5 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 28 7.5 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 28 7.5 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 28 7.5 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 28 7.5 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 28 7.5 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 28 7.5 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 28 7.5 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 28 7.5 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 28 7.5 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 28 7.5 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 28 7.5 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 28 7.5 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 28 7.5 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 28 7.5 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 28 7.5 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 28 7.5 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 28 7.5 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 28 7.5 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 28 7.5 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 28 7.5 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_31002| Best HMM Match : RhoGAP (HMM E-Value=0) 28 9.9 SB_29517| Best HMM Match : Transposase_33 (HMM E-Value=6.9) 28 9.9 >SB_14570| Best HMM Match : Mab-21 (HMM E-Value=0.00069) Length = 639 Score = 38.3 bits (85), Expect = 0.007 Identities = 29/93 (31%), Positives = 41/93 (44%), Gaps = 1/93 (1%) Frame = +2 Query: 506 QKTDEVRSWRISMQNQE-RLLMHKTNNLRPALRLMKKLRDAQGMNAIASYFIKTLFLFEI 682 Q DE WR+S E RL T R L L+K ++ I+SYF+K L +E Sbjct: 250 QVMDEFE-WRMSFSLAENRLAQSLTPVQRHTLVLLKIIKKVYFPEVISSYFLKNLLFWEC 308 Query: 683 VKVDDITFWSKNSPSKLFKLMVSRLHESSLAGN 781 + +FW + K M+ RL + GN Sbjct: 309 ENNGE-SFWKGTTSGKCLLRMLDRLQDCFEKGN 340 >SB_25577| Best HMM Match : Mab-21 (HMM E-Value=1e-05) Length = 492 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 3/80 (3%) Frame = +2 Query: 530 WRISMQNQERLLM-HKTNNLRPALRLMKKL--RDAQGMNAIASYFIKTLFLFEIVKVDDI 700 WR+S N E+ L H T +R + K + ++ N ++SY++KT+FL++ ++ Sbjct: 371 WRLSFSNAEKTLFAHMTELMRHCFCVFKGIYYQELTTPNVLSSYYLKTIFLWKCERMPMN 430 Query: 701 TFWSKNSPSKLFKLMVSRLH 760 + +N + L+ LH Sbjct: 431 VWVERNVAQVIMGLLDDLLH 450 >SB_51861| Best HMM Match : RVT_1 (HMM E-Value=1.2e-10) Length = 1318 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +1 Query: 19 CFHEKTNNRNESDIKFEPRHAGYVQLKMGPQFQNLPMRDGVDWQINKTAYL 171 CF +KT E ++ +P Q M P N P+R+G ++NK AYL Sbjct: 742 CFQDKTGEPIEFKLEMDPEATPVAQRPMLPTTCNNPLRNGSIRELNK-AYL 791 >SB_6743| Best HMM Match : Mab-21 (HMM E-Value=0.086) Length = 412 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 6/42 (14%) Frame = +3 Query: 315 SQSGPAETLIITNKS------KGFSLSVDLVPALKFPENRWP 422 + +GPA TL+IT + K LS+DLVPAL F + P Sbjct: 204 TDNGPATTLVITYREGDKPQEKNRRLSIDLVPALLFKDKTKP 245 >SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3464 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/74 (25%), Positives = 37/74 (50%) Frame = +1 Query: 421 RSRSSTDKYPRIAAKVPGSLSANRIRRPPKNRRSPVVAYIHAEPGEALDAQDQ*SATSLA 600 R ++ +A+ ++S +I + + RRS VA + A+ A+ + +A + A Sbjct: 1222 RQLGDIERTKHVASAQQETVSLAQILKARQARRSAAVASMEAQNAVAMVRSETAAAVAKA 1281 Query: 601 TDEEVERRARHERD 642 TDE V R+R + + Sbjct: 1282 TDELVRIRSREKSE 1295 >SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 29.5 bits (63), Expect = 3.2 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = -3 Query: 543 MDIRHDRTS---SVFWRPPYSVCRQAARYLCGNSGVFVGTAS*SAIDFPETSAP 391 +DIR DR + S W P V R A +Y+ VFVG + I+F E AP Sbjct: 12 LDIRPDRQTVMTSATWPP--GVQRMADQYMTDPVRVFVGCLDLNVIEFIEGMAP 63 >SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 5/63 (7%) Frame = +1 Query: 472 GSLSA-NRIRRPPK---NRRSPVVAYIHAEPGE-ALDAQDQ*SATSLATDEEVERRARHE 636 GS++A +R+RR + NRRS VAY+ + E A+ + + + +EEVE R + Sbjct: 1018 GSMTAQSRVRRQRRLRENRRSTGVAYMPTDEAEDDSTAEARAAKRNTKVNEEVEERPSYR 1077 Query: 637 RDR 645 R R Sbjct: 1078 RSR 1080 >SB_11982| Best HMM Match : GST_N (HMM E-Value=7.9e-15) Length = 221 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 632 MNAIASYFIKTLFLFEIVKVDDITFWSKNSPSKLFKLMV 748 MN A+Y I TLFLF++ D I F + ++ +F M+ Sbjct: 154 MNEQATYQITTLFLFQLTYADIILFSTSDTFESMFPGML 192 >SB_9403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 29.1 bits (62), Expect = 4.3 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 5/89 (5%) Frame = +2 Query: 530 WRISMQNQERLLMHKTNNLRPA--LRLMKKL--RDAQGMNAIASYFIKTLFLFEIVKVDD 697 W+I N +R L+H N A LR++K L D AI +++ + ++ K Sbjct: 437 WQIKFLNGQRALIHHEGNEAKAKCLRIVKVLCEVDLSYPKAIRPQYLENILMWASRKYWS 496 Query: 698 ITFWSK-NSPSKLFKLMVSRLHESSLAGN 781 + W++ N P++ LM LH+ G+ Sbjct: 497 DSDWTEANLPARFLDLMAG-LHKCMKNGD 524 >SB_26017| Best HMM Match : Extensin_2 (HMM E-Value=0.11) Length = 1704 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 380 GLGAGAEVSGKSMADHEAVPTNTPELPQRY 469 G+ A SG S+ H+A + P+LP RY Sbjct: 409 GINAKLTFSGSSLPQHKAHDSTLPQLPGRY 438 >SB_3202| Best HMM Match : AFP (HMM E-Value=2.9) Length = 460 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -2 Query: 679 FKQKQCFDEVTG-DRVHALRVSQLLHQSQGWSQIIGLVHQEPLLVLHGY 536 F + Q FDE+ G D +H Q ++ QG++++ G + LHG+ Sbjct: 34 FDELQGFDELHGFDELHGFNELQGFNELQGFNELQGFDELQGFDELHGF 82 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 462 CVRRKYRIRRHSPFRLRNC 480 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 55 CVRRKYRIRRHSPFRLRNC 73 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 636 CVRRKYRIRRHSPFRLRNC 654 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 545 CVRRKYRIRRHSPFRLRNC 563 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_14744| Best HMM Match : 7tm_1 (HMM E-Value=4e-11) Length = 372 Score = 28.3 bits (60), Expect = 7.5 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 7/101 (6%) Frame = -1 Query: 605 SVARLVADYWSCASRASPGSAWIYATTGLRRFFGGLLIRFADKLPGTFAAIRGYLS---- 438 SV R+ A W R + +I + + GLL+ P F AI LS Sbjct: 193 SVERMHATVWPLRHRNTKPRMYIVFI--MITWLSGLLLSGLTYAP-IFVAIGAALSFGLI 249 Query: 437 ---VLLRDRPSIFRKLQRRHQVHA*AKSFRFIRNDQRLRRT 324 VL+ +IF K++R+HQ+H + R I+ ++ L +T Sbjct: 250 LFLVLVVSYATIFIKVKRQHQLHNQSHLQRTIQKERELAKT 290 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 178 CVRRKYRIRRHSPFRLRNC 196 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 904 CVRRKYRIRRHSPFRLRNC 922 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 252 CVRRKYRIRRHSPFRLRNC 270 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 58 CVRRKYRIRRHSPFRLRNC 76 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 28.3 bits (60), Expect = 7.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 275 CIQRERR*VRHSPFSVRSC 331 C++R+ R RHSPF +R+C Sbjct: 9 CVRRKYRIRRHSPFRLRNC 27 >SB_31002| Best HMM Match : RhoGAP (HMM E-Value=0) Length = 1250 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -3 Query: 528 DRTSSVFWRPPYSVCRQAARYLCG--NSGVFVGTAS*SAIDFPETSAP 391 + TSS +WR SV R+ + CG N + + T PE P Sbjct: 563 ETTSSTYWRNQTSVKRRFVNFCCGVDNDDMIIKTEEACPFTMPEFLLP 610 >SB_29517| Best HMM Match : Transposase_33 (HMM E-Value=6.9) Length = 201 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +3 Query: 315 SQSGPAETLIITNKSKGFSLSVDLVPALKFPENR 416 ++ GPA TL + K L +DLVPAL F +++ Sbjct: 3 NKKGPAATLNVQATDK--ELDIDLVPALLFKDDK 34 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,851,459 Number of Sequences: 59808 Number of extensions: 608557 Number of successful extensions: 1749 Number of sequences better than 10.0: 85 Number of HSP's better than 10.0 without gapping: 1630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1748 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -