BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31055 (730 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 24 1.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 5.2 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 9.0 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.0 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.0 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.0 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 9.0 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 24.2 bits (50), Expect = 1.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 668 FASNRRYSCISSFFVIFDRRSHCASSY 588 FAS R YS S V R S C +Y Sbjct: 429 FASGRYYSAYSLHHVRSSRESSCEQTY 455 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -1 Query: 259 VSSTLAGFCFSTMDGAPTTG 200 +S+T+AG + + G P+TG Sbjct: 836 MSTTMAGVIYPPVIGTPSTG 855 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 463 QYTSDAFSTHS*FQFCVDSDD 525 +YT++ F T F F D +D Sbjct: 196 RYTTEGFLTTCSFDFLTDDED 216 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 460 VQYTSDAFSTHS*FQFCVDSDDNYFYALPEDEEE 561 +Q+ S+H FQ + S +NY+ E EE Sbjct: 529 MQFGDKLESSHDSFQAALRSIENYYSGKLERTEE 562 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 460 VQYTSDAFSTHS*FQFCVDSDDNYFYALPEDEEE 561 +Q+ S+H FQ + S +NY+ E EE Sbjct: 567 MQFGDKLESSHDSFQAALRSIENYYSGKLERTEE 600 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +3 Query: 201 PVVGAPSIVEKQKPASVDETSKRK 272 PV+ ++ ++Q P S ET+ +K Sbjct: 770 PVIKPANVNKEQSPNSTKETTPKK 793 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 463 QYTSDAFSTHS*FQFCVDSDD 525 +YT++ F T F F D +D Sbjct: 196 RYTTEGFLTTCSFDFLTDDED 216 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,489 Number of Sequences: 438 Number of extensions: 4247 Number of successful extensions: 22 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -