BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31053 (743 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 25 3.3 AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-b... 24 5.7 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 5.7 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 455 PGNGMPEVVRSGGRAQASIFYEKRMGAEVEADQ 553 PG+G EVVR R + + ++ A AD+ Sbjct: 216 PGDGPDEVVRKDRRGELFFYMHSQLIARYNADR 248 >AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-binding protein OBPjj2 protein. Length = 228 Score = 23.8 bits (49), Expect = 5.7 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 624 FIGNPCLSLPPATRS 580 F GNPCL PP ++ Sbjct: 55 FAGNPCLKGPPVPKN 69 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 5.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 452 VPGNGMPEVVRSGGRAQA 505 VPG+G+P SGG A Sbjct: 3225 VPGSGLPAAAASGGAPSA 3242 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 729,025 Number of Sequences: 2352 Number of extensions: 14642 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -