Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV31051
         (765 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated...    23   2.4  
AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase ...    23   2.4  
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    23   4.1  
DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    22   7.2  
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    21   9.5  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    21   9.5  

>DQ667195-1|ABG75747.1|  469|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 469

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 489 DCPLTSEGWTH 521
           +CPL  E WTH
Sbjct: 155 ECPLIFESWTH 165


>AY855337-1|AAW47987.1|  510|Apis mellifera tyrosine hydroxylase
           protein.
          Length = 510

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 18/71 (25%), Positives = 28/71 (39%)
 Frame = +3

Query: 42  PLLVDVHPPHHGQEVAASGLGLYQAQVNKVASFSIDTLGRPAREFDVVVSGPGSRALPVR 221
           PLL D       QE+  + LG    ++ K+++    T+     EF +   GP  +A    
Sbjct: 345 PLLADPSFAQFSQEIGLASLGASDEEIEKLSTIYWFTV-----EFGLCKEGPDVKAYGAG 399

Query: 222 CYQTKSGLLQA 254
                  LL A
Sbjct: 400 LLSAYGELLHA 410


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 8/20 (40%), Positives = 11/20 (55%)
 Frame = -2

Query: 554 EGTVGRNRTLCVCPSFGCQR 495
           E     N+TLC C +  C+R
Sbjct: 661 ESYSSNNKTLCKCDAQNCRR 680


>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 655 NIWRQNCFY 629
           NIWR +CF+
Sbjct: 86  NIWRPDCFF 94


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = +1

Query: 148 TPWVDLLGNSTWS 186
           T WV + G S WS
Sbjct: 162 TNWVGVFGGSAWS 174


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = +1

Query: 148 TPWVDLLGNSTWS 186
           T WV + G S WS
Sbjct: 162 TNWVGVFGGSAWS 174


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 244,170
Number of Sequences: 438
Number of extensions: 5796
Number of successful extensions: 12
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 23911269
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)