BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31043 (751 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe... 27 2.9 >SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 830 Score = 27.1 bits (57), Expect = 2.9 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = -1 Query: 316 NTIRRATPVHCKYIF-NISLTKKLYTKSTQAKVNSIINNYVLLFK*DSTCVNLYT*RHAS 140 +T TP K + N SL + + S + ++ Y LL K + S Sbjct: 197 STSENLTPTSSKSLASNTSLVQSFNSASRSSSISGNQYTYNLLGKSTDESPKITISAGTS 256 Query: 139 LSTIPSAHSRIYQLRK 92 +S PSA S++ Q+R+ Sbjct: 257 MSHFPSASSKLIQMRR 272 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,865,163 Number of Sequences: 5004 Number of extensions: 59276 Number of successful extensions: 112 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -