BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31043 (751 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_04_0133 + 16477502-16479475 30 2.3 01_01_0420 + 3175544-3176696,3177035-3178581,3179623-3179688,317... 28 6.9 >01_04_0133 + 16477502-16479475 Length = 657 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = -1 Query: 148 HASLSTIPSAHSRIYQLRKMMPDSFTKNTTTMLNYYLKLYYYSTAA 11 + ++S +PSA S I++L MPD T TMLN Y+K + AA Sbjct: 188 YGAVSQVPSARS-IFEL---MPDRNTVTWNTMLNCYVKAGMINMAA 229 >01_01_0420 + 3175544-3176696,3177035-3178581,3179623-3179688, 3179892-3179999 Length = 957 Score = 28.3 bits (60), Expect = 6.9 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 353 TNSGSQWCAVCPNNAPN 403 +NSG+QWC N++PN Sbjct: 229 SNSGAQWCDALANSSPN 245 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,310,314 Number of Sequences: 37544 Number of extensions: 297046 Number of successful extensions: 448 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 448 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -