BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31043 (751 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 27 0.62 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.6 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 23 7.6 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 23 7.6 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 23 7.6 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 23 7.6 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 23 7.6 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 7.6 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 27.1 bits (57), Expect = 0.62 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 386 GTLHTTESPNLSYIILITTVAPLEHN 309 G LH ++ +YI+L+ V PL+ N Sbjct: 524 GALHVKQAFEYAYIVLVQAVLPLDKN 549 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 7.6 Identities = 18/68 (26%), Positives = 31/68 (45%) Frame = -1 Query: 241 KSTQAKVNSIINNYVLLFK*DSTCVNLYT*RHASLSTIPSAHSRIYQLRKMMPDSFTKNT 62 +ST + S + N F+ + +YT HA+ ++P HS + L K+ F Sbjct: 586 RSTSTNLMSFVTNIFRSFEAGTQLDAIYTDFHAAFDSLP--HSLL--LAKLSKLGFGDGI 641 Query: 61 TTMLNYYL 38 + L+ YL Sbjct: 642 ISWLSSYL 649 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 725 YYYVHKKNLYKIIKMASIL 669 YY+ H K +KI+K +++L Sbjct: 165 YYWFHIKYFFKIMKNSAVL 183 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 725 YYYVHKKNLYKIIKMASIL 669 YY+ H K +KI+K +++L Sbjct: 165 YYWFHIKYFFKIMKNSAVL 183 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 725 YYYVHKKNLYKIIKMASIL 669 YY+ H K +KI+K +++L Sbjct: 165 YYWFHIKYFFKIMKNSAVL 183 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 725 YYYVHKKNLYKIIKMASIL 669 YY+ H K +KI+K +++L Sbjct: 165 YYWFHIKYFFKIMKNSAVL 183 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 725 YYYVHKKNLYKIIKMASIL 669 YY+ H K +KI+K +++L Sbjct: 165 YYWFHIKYFFKIMKNSAVL 183 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 725 YYYVHKKNLYKIIKMASIL 669 YY+ H K +KI+K +++L Sbjct: 392 YYWFHIKYFFKIMKNSAVL 410 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,356 Number of Sequences: 2352 Number of extensions: 15763 Number of successful extensions: 63 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -