BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV31038 (779 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47280| Best HMM Match : DUF655 (HMM E-Value=2.2) 31 1.4 SB_31610| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) 30 2.4 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_29963| Best HMM Match : E-MAP-115 (HMM E-Value=1.6) 29 3.2 SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) 29 3.2 SB_54260| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_50703| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_17867| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_41427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_33874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) 29 5.6 SB_21276| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_38766| Best HMM Match : 7tm_1 (HMM E-Value=1e-07) 28 7.4 SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_28413| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_9586| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_58849| Best HMM Match : zf-piccolo (HMM E-Value=2.8) 28 9.8 SB_53565| Best HMM Match : Amino_oxidase (HMM E-Value=9.7e-19) 28 9.8 SB_7981| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 >SB_47280| Best HMM Match : DUF655 (HMM E-Value=2.2) Length = 508 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +2 Query: 371 EEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQ 475 EE+D+ + +ND E++PLS + A++ +SKR Q Sbjct: 261 EEIDDTD-ERNDELEEKDPLSPSSGAKDDSSKRKQ 294 >SB_31610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/68 (26%), Positives = 31/68 (45%) Frame = +2 Query: 365 EIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDMESLEKFQQVIVTIR 544 E EE +EE + + + EEE ++ EE + E + + E E+ ++ T R Sbjct: 24 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEGEEEEEEEEEEEEEEEEEEEEEEATFR 83 Query: 545 RLLHQVLV 568 R + LV Sbjct: 84 RHVRGALV 91 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +2 Query: 365 EIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDMESLEKFQQ 526 E EE +EE + + + EEE ++ EE + + EG+ + E E+ ++ Sbjct: 18 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEGEEEEEEEEEEEEEE 71 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/55 (23%), Positives = 27/55 (49%) Frame = +2 Query: 362 FEIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDMESLEKFQQ 526 F +EE +EE + + + EEE ++ EE + + E + + E E+ ++ Sbjct: 11 FHVEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEGEEEEEEEE 65 >SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) Length = 1291 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 503 PCHLKNLPHFDSVSMQLLRH*PYHLEVLPHLDCHF 399 P H + L H S +LLRH P+H VL H H+ Sbjct: 1007 PFHYRLLRHH-SFHYRLLRHHPFHYRVLRHHPFHY 1040 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +2 Query: 365 EIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDMESLEKFQQ 526 E+EE +EE + + + EEE ++ EE K + E + + E E+ ++ Sbjct: 204 EVEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEEEEEEEEEEEEEEE 257 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +2 Query: 353 SVLFEIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDMESLEKFQQ 526 SV+ E EE +EE + + + EEE ++ EE + + E + + E E+ ++ Sbjct: 192 SVVEEEEEEEEEEVEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEEEEEEE 249 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +2 Query: 365 EIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDMESLEKFQQ 526 E EEV+EE + + + EEE ++ EE + + E + + E E+ ++ Sbjct: 201 EEEEVEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEEEEEEEEEEEE 254 >SB_29963| Best HMM Match : E-MAP-115 (HMM E-Value=1.6) Length = 238 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = +2 Query: 398 KNDSQGEEEPLSDKASA---EEVASKRNQNEGDSLNDMESLEKFQQVIVTIRRLLHQV 562 K+D +G++E + KA E++ ++ D++ND E++EK QQ++ I Q+ Sbjct: 138 KSDDEGDDEKKALKAHTQKNEQLVPTNDEVVDDTVNDSETIEK-QQLVERIEEYESQI 194 >SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) Length = 205 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 365 EIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDME 505 E EE +EE + GEEE ++D+ +SK NE D N+ + Sbjct: 107 EEEEEEEEKEEGKEEDGEEEVVTDERGIS--SSKDESNESDESNESD 151 >SB_54260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +2 Query: 365 EIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDMESLEK 517 E EE +EE + + + EEE ++ EE + + EG+ + E E+ Sbjct: 6 EEEEEEEEEEEEEEEEEEEEEKEEEEEEEEEEEEEEEEEGEEEEEEEEEEE 56 >SB_50703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 365 EIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDME 505 E EEV+EE + + + EEE ++ EE K ++ E + + E Sbjct: 51 EEEEVEEEEEEEEEEEEEEEEEEEEEEEEEEEEKEDKQEEEDKQEEE 97 >SB_17867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 365 EIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDS 490 E EE +EE K + + EEE ++ +E +K+N+N+ S Sbjct: 20 EEEEEEEEEEEKEEEEEEEEEEEEEEEDKEDDNKKNKNKKSS 61 >SB_41427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 428 LSDKASAEEVASKRNQNEGDSLNDMESLEKFQQVIVTI 541 +SD ASAE ++SKRN+ SLN +E++ I T+ Sbjct: 3 ISDSASAEFLSSKRNKKR--SLNSIENIVAALSAINTV 38 >SB_33874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +2 Query: 359 LFEIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDMES 508 L I E+ + + QGE E + +A EEV R + + +++ D+E+ Sbjct: 69 LVNIPSEQSEDDNEVEEQGEAEDIKSEAKKEEVLKIREKVKEENMKDLEA 118 >SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) Length = 550 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/52 (30%), Positives = 30/52 (57%) Frame = +2 Query: 362 FEIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDMESLEK 517 FE ++ + +N K D + +EE LS +EV++ N N +S D++S ++ Sbjct: 143 FEPQDTEIQNVEKGDEE-DEEILSIN---DEVSTNNNNNNEESAEDLDSTKQ 190 >SB_21276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 28.7 bits (61), Expect = 5.6 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +1 Query: 562 TSGDRDVGATSIGETLKRINADLLVEFPAKKPKPELFTVDKGPKWYSIANEMVTPPIITK 741 T+ D+ G+ E KR+ L V F + + F P Y + E PP ITK Sbjct: 31 TARDKSGGSGRTQEANKRVVNFLDVTFDLNRNTYQPFFKPNAPLQY-VHRESNHPPTITK 89 Query: 742 NLP 750 N+P Sbjct: 90 NIP 92 >SB_38766| Best HMM Match : 7tm_1 (HMM E-Value=1e-07) Length = 625 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 223 FCDPELLVLYLIFL 182 FCDPE+ VLYL+ L Sbjct: 560 FCDPEIAVLYLVLL 573 >SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = +2 Query: 371 EEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSL 493 E+ +EE+ +++ + EEE ++K + + + +K + DSL Sbjct: 643 EKEEEESEEESEEESEEEEETEKVNKDALKAKATEKSNDSL 683 >SB_28413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = +1 Query: 601 ETLKRINADLLVEFPAKKPKPELFTVDKGPKWYSIANEMVTPPIITKNLP 750 E KR+ L V F + + FT P Y + E PP ITKN+P Sbjct: 67 EANKRVVIFLDVTFDLNRNTYQPFTKPNAPLQY-VHRESNHPPTITKNIP 115 >SB_9586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = +1 Query: 601 ETLKRINADLLVEFPAKKPKPELFTVDKGPKWYSIANEMVTPPIITKNLP 750 E KR+ L V F + + FT P Y + E PP ITKN+P Sbjct: 971 EAKKRVVNFLDVTFDLNRNTYQPFTKPSAPLQY-VHRESNHPPTITKNIP 1019 >SB_58849| Best HMM Match : zf-piccolo (HMM E-Value=2.8) Length = 243 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/50 (38%), Positives = 23/50 (46%) Frame = +1 Query: 601 ETLKRINADLLVEFPAKKPKPELFTVDKGPKWYSIANEMVTPPIITKNLP 750 E KRI L V F + + FT P Y + E PP ITKN+P Sbjct: 138 EANKRIVNFLDVTFDLNRNTYQPFTKPNAPLQY-VHRESNHPPTITKNIP 186 >SB_53565| Best HMM Match : Amino_oxidase (HMM E-Value=9.7e-19) Length = 438 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 365 EIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDMESL 511 E EE +EE + + + EEE DK EE + + E + + E + Sbjct: 37 EEEEEEEEEEEEEEEEEEEEEEEDKEEEEEEEEEEEEEEEEEEEEEEEV 85 >SB_7981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = +2 Query: 365 EIEEVDEENFPKNDSQGEEEPLSDKASAEEVASKRNQNEGDSLNDMESLE 514 E EEV++E + + + E + ++++ EEV NQ EG+ +N E E Sbjct: 23 EGEEVNQEEGEEVNEEEEGKEMNEEEEGEEV----NQEEGEEVNQEEGEE 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,256,897 Number of Sequences: 59808 Number of extensions: 369872 Number of successful extensions: 1489 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1340 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -